Q9Y5S8 (NOX1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: NADPH oxidase 1 Short name=NOX-1 EC=1.-.-.- Alternative name(s): Mitogenic oxidase 1 Short name=MOX-1 NADH/NADPH mitogenic oxidase subunit P65-MOX NOH-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 564 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | NOH-1S is a voltage-gated proton channel that mediates the H+ currents of resting phagocytes and other tissues. It participates in the regulation of cellular pH and is blocked by zinc. NOH-1L is a pyridine nucleotide-dependent oxidoreductase that generates superoxide and might conduct H+ ions as part of its electron transport mechanism, whereas NOH-1S does not contain an electron transport chain. |
| Cofactor | NADP Potential. FAD Potential. |
| Enzyme regulation | The oxidase activity is potentiated by NOXA1 and NOXO1. Ref.8 Ref.9 |
| Subunit structure | NOX1, NOXA1, NOXO1, RAC1 and CYBA forms a functional multimeric complex supporting ROS production. Interacts with NOXA1 and NOXO1. Ref.9 Ref.10 |
| Subcellular location | Cell projection › invadopodium membrane; Multi-pass membrane protein Ref.11. |
| Tissue specificity | NOH-1L is detected in colon, uterus, prostate, and colon carcinoma, but not in peripheral blood leukocytes. NOH-1S is detected only in colon and colon carcinoma cells. |
| Sequence similarities | Contains 1 FAD-binding FR-type domain. Contains 1 ferric oxidoreductase domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform NOH-1L (identifier: Q9Y5S8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform NOH-1S (identifier: Q9Y5S8-2) The sequence of this isoform differs from the canonical sequence as follows: 159-190: QSRNTTVEYVTFTSIAGLTGVIMTIALILMVT → HPHITPTVYMFTVTFDMVLSSVNSNLLFLLIK 191-564: Missing. | ||||||
| Isoform NOH-1LV (identifier: Q9Y5S8-3) The sequence of this isoform differs from the canonical sequence as follows: 433-481: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 564 | 564 | NADPH oxidase 1 | PRO_0000210148 | |||||
Regions | |||||||||
| Topological domain | 1 – 9 | 9 | Cytoplasmic Potential | ||||||
| Transmembrane | 10 – 30 | 21 | Helical; Potential | ||||||
| Topological domain | 31 – 44 | 14 | Extracellular Potential | ||||||
| Transmembrane | 45 – 72 | 28 | Helical; Potential | ||||||
| Topological domain | 73 – 102 | 30 | Cytoplasmic Potential | ||||||
| Transmembrane | 103 – 123 | 21 | Helical; Potential | ||||||
| Topological domain | 124 – 168 | 45 | Extracellular Potential | ||||||
| Transmembrane | 169 – 189 | 21 | Helical; Potential | ||||||
| Topological domain | 190 – 206 | 17 | Cytoplasmic Potential | ||||||
| Transmembrane | 207 – 227 | 21 | Helical; Potential | ||||||
| Topological domain | 228 – 396 | 169 | Extracellular Potential | ||||||
| Transmembrane | 397 – 417 | 21 | Helical; Potential | ||||||
| Topological domain | 418 – 564 | 147 | Cytoplasmic Potential | ||||||
| Domain | 54 – 283 | 230 | Ferric oxidoreductase | ||||||
| Domain | 284 – 391 | 108 | FAD-binding FR-type | ||||||
| Nucleotide binding | 338 – 344 | 7 | FAD Potential | ||||||
| Region | 397 – 536 | 140 | Interaction with NOXO1 | ||||||
Sites | |||||||||
| Metal binding | 101 | 1 | Iron (heme axial ligand) Probable | ||||||
| Metal binding | 115 | 1 | Iron (heme axial ligand) Probable | ||||||
| Metal binding | 209 | 1 | Iron (heme axial ligand) Probable | ||||||
| Metal binding | 221 | 1 | Iron (heme axial ligand) Probable | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 162 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 236 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 159 – 190 | 32 | QSRNT…ILMVT → HPHITPTVYMFTVTFDMVLS SVNSNLLFLLIK in isoform NOH-1S. | VSP_001577 | |||||
| Alternative sequence | 191 – 564 | 374 | Missing in isoform NOH-1S. | VSP_001578 | |||||
| Alternative sequence | 433 – 481 | 49 | Missing in isoform NOH-1LV. | VSP_001579 | |||||
| Natural variant | 315 | 1 | R → H. Corresponds to variant rs2071756 [ dbSNP | Ensembl ]. | VAR_049101 | |||||
| Natural variant | 360 | 1 | D → N. Corresponds to variant rs34688635 [ dbSNP | Ensembl ]. | VAR_061176 | |||||
| Natural variant | 378 | 1 | R → K. Corresponds to variant rs35404864 [ dbSNP | Ensembl ]. | VAR_049102 | |||||
Experimental info | |||||||||
| Sequence conflict | 173 | 1 | I → V in AAD38133. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cell transformation by the superoxide-generating oxidase Mox1." Suh Y.-A., Arnold R.S., Lassegue B., Shi J., Xu X., Sorescu D., Chung A.B., Griendling K.K., Lambeth J.D. Nature 401:79-82(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM NOH-1L). Tissue: Colon epithelium. |
| [2] | "A mammalian H+ channel, generated through alternative splicing of the NADPH oxidase homolog NOH-1." Banfi B., Maturana A., Jaconi S., Arnaudeau S., Laforge T., Sinha B., Ligeti E., Demaurex N., Krause K.-H. Science 287:138-142(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS NOH-1L; NOH-1LV AND NOH-1S). |
| [3] | NHLBI resequencing and genotyping service (RS&G) Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM NOH-1L). Tissue: Colon. |
| [5] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM NOH-1L). |
| [8] | "NOXO1, regulation of lipid binding, localization, and activation of Nox1 by the Phox homology (PX) domain." Cheng G., Lambeth J.D. J. Biol. Chem. 279:4737-4742(2004) [PubMed] [Europe PMC] [Abstract] Cited for: ENZYME REGULATION. |
| [9] | "Molecular interaction of NADPH oxidase 1 with betaPix and Nox Organizer 1." Park H.S., Park D., Bae Y.S. Biochem. Biophys. Res. Commun. 339:985-990(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NOXO1, ENZYME REGULATION. |
| [10] | "Nox1-dependent reactive oxygen generation is regulated by Rac1." Cheng G., Diebold B.A., Hughes Y., Lambeth J.D. J. Biol. Chem. 281:17718-17726(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX CONTAINING NOX1; NOXO1; NOXA1 AND RAC1. |
| [11] | "Novel p47(phox)-related organizers regulate localized NADPH oxidase 1 (Nox1) activity." Gianni D., Diaz B., Taulet N., Fowler B., Courtneidge S.A., Bokoch G.M. Sci. Signal. 2:RA54-RA54(2009) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF127763 mRNA. Translation: AAD38133.1. AF166326 mRNA. Translation: AAF23232.1. AF166327 mRNA. Translation: AAF23233.1. AF166328 mRNA. Translation: AAF23234.1. DQ314883 Genomic DNA. Translation: ABC40742.1. AK292201 mRNA. Translation: BAF84890.1. Z83819 Genomic DNA. Translation: CAI42336.1. Z83819 Genomic DNA. Translation: CAI42337.1. CH471115 Genomic DNA. Translation: EAX02820.1. BC075014 mRNA. Translation: AAH75014.1. BC075015 mRNA. Translation: AAH75015.1. |
| IPI | IPI00216593. IPI00292186. IPI00336126. |
| RefSeq | NP_001258744.1. NM_001271815.1. NP_008983.2. NM_007052.4. NP_039249.1. NM_013955.2. |
| UniGene | Hs.592227. |
3D structure databases | |
| ProteinModelPortal | Q9Y5S8. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000362057. |
Protein family/group databases | |
| PeroxiBase | 5410. HsNOx01. |
| TCDB | 5.B.1.1.3. phagocyte (gp91phox) NADPH oxidase family. |
PTM databases | |
| PhosphoSite | Q9Y5S8. |
Polymorphism databases | |
| DMDM | 8134597. |
Proteomic databases | |
| PaxDb | Q9Y5S8. |
| PRIDE | Q9Y5S8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000217885; ENSP00000217885; ENSG00000007952. ENST00000372966; ENSP00000362057; ENSG00000007952. |
| GeneID | 27035. |
| KEGG | hsa:27035. |
| UCSC | uc004egj.3. human. uc004egl.4. human. |
Organism-specific databases | |
| CTD | 27035. |
| GeneCards | GC0XM100098. |
| HGNC | HGNC:7889. NOX1. |
| HPA | HPA035299. HPA035300. |
| MIM | 300225. gene. |
| neXtProt | NX_Q9Y5S8. |
| PharmGKB | PA31690. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG287712. |
| HOGENOM | HOG000216669. |
| HOVERGEN | HBG003760. |
| InParanoid | Q9Y5S8. |
| KO | K08008. |
| OMA | KEFWEQI. |
| OrthoDB | EOG4Z8XW4. |
| PhylomeDB | Q9Y5S8. |
Gene expression databases | |
| ArrayExpress | Q9Y5S8. |
| Bgee | Q9Y5S8. |
| CleanEx | HS_NOX1. |
| Genevestigator | Q9Y5S8. |
| GermOnline | ENSG00000007952. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000778. Cyt_b245_heavy_chain. IPR013112. FAD-bd_8. IPR017927. Fd_Rdtase_FAD-bd. IPR013130. Fe3_Rdtase_TM_dom. IPR013121. Fe_red_NAD-bd_6. IPR017938. Riboflavin_synthase-like_b-brl. [Graphical view] |
| Pfam | PF08022. FAD_binding_8. 1 hit. PF01794. Ferric_reduct. 1 hit. PF08030. NAD_binding_6. 1 hit. [Graphical view] |
| PRINTS | PR00466. GP91PHOX. |
| SUPFAM | SSF63380. Riboflavin_synthase_like_b-brl. 1 hit. |
| PROSITE | PS51384. FAD_FR. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q9Y5S8. |
| ChEMBL | CHEMBL1287628. |
| GenomeRNAi | 27035. |
| NextBio | 49586. |
| SOURCE | Search... |
Entry information
| Entry name | NOX1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y5S8 Secondary accession number(s): A8K836, O95691, Q2PP02 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
