Q9Y5L0 (TNPO3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transportin-3 Alternative name(s): Importin-12 Short name=Imp12 Transportin-SR Short name=TRN-SR | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 923 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Seems to function in nuclear protein import as nuclear transport receptor. In vitro, mediates the nuclear import of splicing factor SR proteins RBM4, SFRS1 and SFRS2, by recognizing phosphorylated RS domains. Ref.1 Ref.7 Ref.8 Ref.9 |
| Subunit structure | Interacts with phosphorylated SFRS1 and SFRS2. Interacts with NUP62 and RBM4. Ref.1 Ref.7 Ref.8 Ref.9 |
| Subcellular location | |
| Sequence caution | The sequence AAD38537.1 differs from that shown. Reason: Frameshift at position 920. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein transport Transport |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | splicing factor protein import into nucleus Inferred from direct assay Ref.9. Source: UniProtKB |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from direct assay. Source: HPA |
| Molecular_function | receptor activity Traceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: Q9Y5L0-2) Also known as: TRN-SR2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q9Y5L0-1) The sequence of this isoform differs from the canonical sequence as follows: 453-453: P → PKKPFSNAACHHSLLFGQNITSEISNCEYLPPVLR | ||||||
| Isoform 3 (identifier: Q9Y5L0-3) The sequence of this isoform differs from the canonical sequence as follows: 904-923: SAEECKQVCWALRDFTRLFR → RNVFFN | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9Y5L0-5) The sequence of this isoform differs from the canonical sequence as follows: 500-563: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 923 | 923 | Transportin-3 | PRO_0000120781 | |||||
Amino acid modifications | |||||||||
| Modified residue | 896 | 1 | Phosphothreonine Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 453 | 1 | P → PKKPFSNAACHHSLLFGQNI TSEISNCEYLPPVLR in isoform 1. | VSP_030174 | |||||
| Alternative sequence | 500 – 563 | 64 | Missing in isoform 4. | VSP_045494 | |||||
| Alternative sequence | 904 – 923 | 20 | SAEEC…TRLFR → RNVFFN in isoform 3. | VSP_011178 | |||||
Experimental info | |||||||||
| Sequence conflict | 87 | 1 | R → W in AAD38537. Ref.1 | ||||||
| Sequence conflict | 265 | 1 | L → S in AK225999. Ref.3 | ||||||
| Sequence conflict | 358 | 1 | D → G in AK225999. Ref.3 | ||||||
| Sequence conflict | 480 | 1 | T → A in AK225999. Ref.3 | ||||||
| Sequence conflict | 624 | 1 | P → L in AK225999. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Transportin-SR, a nuclear import receptor for SR proteins." Kataoka N., Bachorik J.L., Dreyfuss G. J. Cell Biol. 145:1145-1152(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH SFRS1 AND SFRS2. |
| [2] | "A human homologue of yeast Mtr10p and its role in nuclear protein import." Kutay U., Izaurralde E., Hartmann E., Goerlich D. Submitted (APR-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Colon. |
| [4] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Human chromosome 7: DNA sequence and biology." Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. Tsui L.-C.Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 586-923 (ISOFORM 3). Tissue: Ovary. |
| [7] | "A human importin-beta family protein, transportin-SR2, interacts with the phosphorylated RS domain of SR proteins." Lai M.-C., Lin R.-I., Huang S.-Y., Tsai C.-W., Tarn W.-Y. J. Biol. Chem. 275:7950-7957(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH SFRS1, SUBCELLULAR LOCATION. |
| [8] | "Transportin-SR2 mediates nuclear import of phosphorylated SR proteins." Lai M.-C., Lin R.-I., Tarn W.-Y. Proc. Natl. Acad. Sci. U.S.A. 98:10154-10159(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH SFRS1 AND NUP62. |
| [9] | "A novel splicing regulator shares a nuclear import pathway with SR proteins." Lai M.-C., Kuo H.-W., Chang W.-C., Tarn W.-Y. EMBO J. 22:1359-1369(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH RBM4. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-896, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF145029 mRNA. Translation: AAD38537.1. Frameshift. AJ133769 mRNA. Translation: CAB42643.1. AK225999 mRNA. No translation available. AC018639 Genomic DNA. No translation available. AC025594 Genomic DNA. No translation available. CH236950 Genomic DNA. Translation: EAL24106.1. BC009221 mRNA. Translation: AAH09221.2. |
| IPI | IPI00395694. IPI00455127. IPI00944945. IPI01009481. |
| RefSeq | NP_001177957.2. NM_001191028.2. NP_036602.1. NM_012470.3. |
| UniGene | Hs.193613. |
3D structure databases | |
| ProteinModelPortal | Q9Y5L0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9Y5L0. 3 interactions. |
| MINT | MINT-1194798. |
| STRING | 9606.ENSP00000265388. |
PTM databases | |
| PhosphoSite | Q9Y5L0. |
Polymorphism databases | |
| DMDM | 166215035. |
Proteomic databases | |
| PaxDb | Q9Y5L0. |
| PRIDE | Q9Y5L0. |
Protocols and materials databases | |
| DNASU | 23534. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000265388; ENSP00000265388; ENSG00000064419. ENST00000471234; ENSP00000418646; ENSG00000064419. |
| GeneID | 23534. |
| KEGG | hsa:23534. |
| UCSC | uc003vol.2. human. |
Organism-specific databases | |
| CTD | 23534. |
| GeneCards | GC07M128594. |
| HGNC | HGNC:17103. TNPO3. |
| HPA | HPA039555. |
| MIM | 610032. gene. |
| neXtProt | NX_Q9Y5L0. |
| Orphanet | 186. Primary biliary cirrhosis. |
| PharmGKB | PA134888159. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG237172. |
| HOGENOM | HOG000273876. |
| HOVERGEN | HBG057505. |
| KO | K15436. |
| OrthoDB | EOG4QRH3B. |
Gene expression databases | |
| ArrayExpress | Q9Y5L0. |
| Bgee | Q9Y5L0. |
| CleanEx | HS_TNPO3. |
| Genevestigator | Q9Y5L0. |
| GermOnline | ENSG00000064419. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.25.10.10. 3 hits. |
| InterPro | IPR011989. ARM-like. IPR016024. ARM-type_fold. IPR013598. Exportin-1/Importin-b-like. [Graphical view] |
| Pfam | PF08389. Xpo1. 1 hit. [Graphical view] |
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 23534. |
| NextBio | 46030. |
| SOURCE | Search... |
Entry information
| Entry name | TNPO3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y5L0 Secondary accession number(s): A4D1K9 Q9Y3R2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
