Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Y5L0 (TNPO3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 108. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Transportin-3
Alternative name(s):
Importin-12
Short name=Imp12
Transportin-SR
Short name=TRN-SR
Gene names
Name:TNPO3
Synonyms:IPO12
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length923 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Seems to function in nuclear protein import as nuclear transport receptor. In vitro, mediates the nuclear import of splicing factor SR proteins RBM4, SFRS1 and SFRS2, by recognizing phosphorylated RS domains. Ref.1 Ref.7 Ref.8 Ref.9

Subunit structure

Interacts with phosphorylated SFRS1 and SFRS2. Interacts with NUP62 and RBM4. Ref.1 Ref.7 Ref.8 Ref.9

Subcellular location

Cytoplasm. Nucleus Ref.7.

Sequence caution

The sequence AAD38537.1 differs from that shown. Reason: Frameshift at position 920.

Ontologies

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 2 (identifier: Q9Y5L0-2)

Also known as: TRN-SR2;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 1 (identifier: Q9Y5L0-1)

The sequence of this isoform differs from the canonical sequence as follows:
     453-453: P → PKKPFSNAACHHSLLFGQNITSEISNCEYLPPVLR
Isoform 3 (identifier: Q9Y5L0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     904-923: SAEECKQVCWALRDFTRLFR → RNVFFN
Note: No experimental confirmation available.
Isoform 4 (identifier: Q9Y5L0-5)

The sequence of this isoform differs from the canonical sequence as follows:
     500-563: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 923923Transportin-3
PRO_0000120781

Amino acid modifications

Modified residue11N-acetylmethionine Ref.10
Modified residue8961Phosphothreonine Ref.11

Natural variations

Alternative sequence4531P → PKKPFSNAACHHSLLFGQNI TSEISNCEYLPPVLR in isoform 1.
VSP_030174
Alternative sequence500 – 56364Missing in isoform 4.
VSP_045494
Alternative sequence904 – 92320SAEEC…TRLFR → RNVFFN in isoform 3.
VSP_011178

Experimental info

Sequence conflict871R → W in AAD38537. Ref.1
Sequence conflict2651L → S in AK225999. Ref.3
Sequence conflict3581D → G in AK225999. Ref.3
Sequence conflict4801T → A in AK225999. Ref.3
Sequence conflict6241P → L in AK225999. Ref.3

Secondary structure

............................................................................................................................ 923
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 2 (TRN-SR2) [UniParc].

Last modified January 15, 2008. Version 3.
Checksum: CF7CDC14CDBA56AB

FASTA923104,203
        10         20         30         40         50         60 
MEGAKPTLQL VYQAVQALYH DPDPSGKERA SFWLGELQRS VHAWEISDQL LQIRQDVESC 

        70         80         90        100        110        120 
YFAAQTMKMK IQTSFYELPT DSHASLRDSL LTHIQNLKDL SPVIVTQLAL AIADLALQMP 

       130        140        150        160        170        180 
SWKGCVQTLV EKYSNDVTSL PFLLEILTVL PEEVHSRSLR IGANRRTEII EDLAFYSSTV 

       190        200        210        220        230        240 
VSLLMTCVEK AGTDEKMLMK VFRCLGSWFN LGVLDSNFMA NNKLLALLFE VLQQDKTSSN 

       250        260        270        280        290        300 
LHEAASDCVC SALYAIENVE TNLPLAMQLF QGVLTLETAY HMAVAREDLD KVLNYCRIFT 

       310        320        330        340        350        360 
ELCETFLEKI VCTPGQGLGD LRTLELLLIC AGHPQYEVVE ISFNFWYRLG EHLYKTNDEV 

       370        380        390        400        410        420 
IHGIFKAYIQ RLLHALARHC QLEPDHEGVP EETDDFGEFR MRVSDLVKDL IFLIGSMECF 

       430        440        450        460        470        480 
AQLYSTLKEG NPPWEVTEAV LFIMAAIAKS VDPENNPTLV EVLEGVVRLP ETVHTAVRYT 

       490        500        510        520        530        540 
SIELVGEMSE VVDRNPQFLD PVLGYLMKGL CEKPLASAAA KAIHNICSVC RDHMAQHFNG 

       550        560        570        580        590        600 
LLEIARSLDS FLLSPEAAVG LLKGTALVLA RLPLDKITEC LSELCSVQVM ALKKLLSQEP 

       610        620        630        640        650        660 
SNGISSDPTV FLDRLAVIFR HTNPIVENGQ THPCQKVIQE IWPVLSETLN KHRADNRIVE 

       670        680        690        700        710        720 
RCCRCLRFAV RCVGKGSAAL LQPLVTQMVN VYHVHQHSCF LYLGSILVDE YGMEEGCRQG 

       730        740        750        760        770        780 
LLDMLQALCI PTFQLLEQQN GLQNHPDTVD DLFRLATRFI QRSPVTLLRS QVVIPILQWA 

       790        800        810        820        830        840 
IASTTLDHRD ANCSVMRFLR DLIHTGVAND HEEDFELRKE LIGQVMNQLG QQLVSQLLHT 

       850        860        870        880        890        900 
CCFCLPPYTL PDVAEVLWEI MQVDRPTFCR WLENSLKGLP KETTVGAVTV THKQLTDFHK 

       910        920 
QVTSAEECKQ VCWALRDFTR LFR 

« Hide

Isoform 1 [UniParc].

Checksum: 6CDFAD0922CBA87F
Show »

FASTA957108,001
Isoform 3 [UniParc].

Checksum: 03F2BCEFA4FAA203
Show »

FASTA909102,541
Isoform 4 [UniParc].

Checksum: 52D04D72633709DC
Show »

FASTA85997,372

References

« Hide 'large scale' references
[1]"Transportin-SR, a nuclear import receptor for SR proteins."
Kataoka N., Bachorik J.L., Dreyfuss G.
J. Cell Biol. 145:1145-1152(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH SFRS1 AND SFRS2.
[2]"A human homologue of yeast Mtr10p and its role in nuclear protein import."
Kutay U., Izaurralde E., Hartmann E., Goerlich D.
Submitted (APR-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[3]Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Colon.
[4]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"Human chromosome 7: DNA sequence and biology."
Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. expand/collapse author list , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 586-923 (ISOFORM 3).
Tissue: Ovary.
[7]"A human importin-beta family protein, transportin-SR2, interacts with the phosphorylated RS domain of SR proteins."
Lai M.-C., Lin R.-I., Huang S.-Y., Tsai C.-W., Tarn W.-Y.
J. Biol. Chem. 275:7950-7957(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH SFRS1, SUBCELLULAR LOCATION.
[8]"Transportin-SR2 mediates nuclear import of phosphorylated SR proteins."
Lai M.-C., Lin R.-I., Tarn W.-Y.
Proc. Natl. Acad. Sci. U.S.A. 98:10154-10159(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH SFRS1 AND NUP62.
[9]"A novel splicing regulator shares a nuclear import pathway with SR proteins."
Lai M.-C., Kuo H.-W., Chang W.-C., Tarn W.-Y.
EMBO J. 22:1359-1369(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH RBM4.
[10]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[11]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-896, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[12]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF145029 mRNA. Translation: AAD38537.1. Frameshift.
AJ133769 mRNA. Translation: CAB42643.1.
AK225999 mRNA. No translation available.
AC018639 Genomic DNA. No translation available.
AC025594 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24106.1.
BC009221 mRNA. Translation: AAH09221.2.
CCDSCCDS55162.1. [Q9Y5L0-5]
CCDS5809.1. [Q9Y5L0-2]
RefSeqNP_001177957.2. NM_001191028.2. [Q9Y5L0-5]
NP_036602.1. NM_012470.3. [Q9Y5L0-2]
UniGeneHs.193613.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
4C0OX-ray2.56A/B1-923[»]
4C0PX-ray2.95A/B/C/D1-923[»]
4C0QX-ray3.42A/B1-923[»]
4OL0X-ray2.90B3-923[»]
ProteinModelPortalQ9Y5L0.
SMRQ9Y5L0. Positions 3-922.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid117080. 29 interactions.
IntActQ9Y5L0. 6 interactions.
MINTMINT-1194798.
STRING9606.ENSP00000265388.

PTM databases

PhosphoSiteQ9Y5L0.

Polymorphism databases

DMDM166215035.

Proteomic databases

MaxQBQ9Y5L0.
PaxDbQ9Y5L0.
PRIDEQ9Y5L0.

Protocols and materials databases

DNASU23534.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000265388; ENSP00000265388; ENSG00000064419. [Q9Y5L0-2]
ENST00000471234; ENSP00000418646; ENSG00000064419. [Q9Y5L0-5]
GeneID23534.
KEGGhsa:23534.
UCSCuc003vol.2. human. [Q9Y5L0-2]

Organism-specific databases

CTD23534.
GeneCardsGC07M128594.
HGNCHGNC:17103. TNPO3.
HPAHPA039555.
HPA041537.
MIM610032. gene.
neXtProtNX_Q9Y5L0.
Orphanet55595. Autosomal dominant limb-girdle muscular dystrophy type 1F.
186. Primary biliary cirrhosis.
PharmGKBPA134888159.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG237172.
HOGENOMHOG000273876.
HOVERGENHBG057505.
KOK15436.
OrthoDBEOG718KC9.
PhylomeDBQ9Y5L0.
TreeFamTF314539.

Gene expression databases

ArrayExpressQ9Y5L0.
BgeeQ9Y5L0.
CleanExHS_TNPO3.
GenevestigatorQ9Y5L0.

Family and domain databases

Gene3D1.25.10.10. 3 hits.
InterProIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR013598. Exportin-1/Importin-b-like.
[Graphical view]
PfamPF08389. Xpo1. 1 hit.
[Graphical view]
SUPFAMSSF48371. SSF48371. 3 hits.
ProtoNetSearch...

Other

GeneWikiTransportin-3.
GenomeRNAi23534.
NextBio46030.
PROQ9Y5L0.
SOURCESearch...

Entry information

Entry nameTNPO3_HUMAN
AccessionPrimary (citable) accession number: Q9Y5L0
Secondary accession number(s): A4D1K9 expand/collapse secondary AC list , C9IZM0, Q6NUM1, Q96G71, Q96GU9, Q9Y3R2
Entry history
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: January 15, 2008
Last modified: July 9, 2014
This is version 108 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM