Q9Y5K3 (PCY1B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Choline-phosphate cytidylyltransferase B EC=2.7.7.15 Alternative name(s): CCT-beta CTP:phosphocholine cytidylyltransferase B Short name=CCT B Short name=CT B Phosphorylcholine transferase B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 369 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Controls phosphatidylcholine synthesis. |
| Catalytic activity | CTP + phosphocholine = diphosphate + CDP-choline. |
| Pathway | |
| Subcellular location | |
| Tissue specificity | Highly expressed in testis, placenta, brain, ovary and fetus. |
| Post-translational modification | Extensively phosphorylated. The beta-1 isoform seems to be much less phosphorylated. |
| Sequence similarities | Belongs to the cytidylyltransferase family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid biosynthesis Lipid metabolism Phospholipid biosynthesis Phospholipid metabolism |
| Cellular component | Endoplasmic reticulum |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Nucleotidyltransferase Transferase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | ovarian follicle development Inferred from electronic annotation. Source: Compara spermatogenesisInferred from electronic annotation. Source: Compara |
| Cellular_component | endoplasmic reticulum membrane Traceable author statement. Source: Reactome |
| Molecular_function | choline-phosphate cytidylyltransferase activity Traceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: Q9Y5K3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q9Y5K3-2) The sequence of this isoform differs from the canonical sequence as follows: 321-369: VSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK → LKSWARCRDF | ||||||
| Isoform 3 (identifier: Q9Y5K3-3) The sequence of this isoform differs from the canonical sequence as follows: 1-16: Missing. 17-39: SLSNEPPSETMEEIEHTCPQPRL → MVGNQECIMEEDNRAPQLWRK | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9Y5K3-4) The sequence of this isoform differs from the canonical sequence as follows: 1-39: MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRL → MVGHQECIMEEDNRAPQLWRK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 369 | 369 | Choline-phosphate cytidylyltransferase B | PRO_0000208456 | |||||
Regions | |||||||||
| Nucleotide binding | 84 – 92 | 9 | CTP By similarity | ||||||
| Nucleotide binding | 168 – 169 | 2 | CTP By similarity | ||||||
| Nucleotide binding | 196 – 200 | 5 | CTP By similarity | ||||||
Sites | |||||||||
| Binding site | 122 | 1 | CTP By similarity | ||||||
| Binding site | 122 | 1 | Substrate By similarity | ||||||
| Binding site | 151 | 1 | Substrate By similarity | ||||||
| Binding site | 173 | 1 | CTP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 315 | 1 | Phosphoserine Ref.8 Ref.10 Ref.11 | ||||||
| Modified residue | 319 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 325 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 362 | 1 | Phosphoserine Ref.11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 39 | 39 | MPVVT…PQPRL → MVGHQECIMEEDNRAPQLWR K in isoform 4. | VSP_044659 | |||||
| Alternative sequence | 1 – 16 | 16 | Missing in isoform 3. | VSP_020045 | |||||
| Alternative sequence | 17 – 39 | 23 | SLSNE…PQPRL → MVGNQECIMEEDNRAPQLWR K in isoform 3. | VSP_020046 | |||||
| Alternative sequence | 321 – 369 | 49 | VSSPT…DEDEK → LKSWARCRDF in isoform 1. | VSP_001226 | |||||
Experimental info | |||||||||
| Sequence conflict | 154 | 1 | T → S in BAG59022. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a second human CTP:phosphocholine cytidylyltransferase." Lykidis A., Murti K.G., Jackowski S. J. Biol. Chem. 273:14022-14029(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Distribution of CTP:phosphocholine cytidylyltransferase (CCT) isoforms. Identification of a new CCTbeta splice variant." Lykidis A., Baburina I., Jackowski S. J. Biol. Chem. 274:26992-27001(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHARACTERIZATION. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4). Tissue: Hippocampus and Thalamus. |
| [4] | SeattleSNPs variation discovery resource Submitted (SEP-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Brain. |
| [8] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-315, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-315, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [11] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-315; SER-319 AND SER-362, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF052510 mRNA. Translation: AAC39754.1. AF148464 mRNA. Translation: AAD35088.1. AK296333 mRNA. Translation: BAG59022.1. AK315323 mRNA. Translation: BAG37725.1. EU181262 Genomic DNA. Translation: ABW03924.1. AC079168 Genomic DNA. No translation available. CH471074 Genomic DNA. Translation: EAW99021.1. BC045634 mRNA. Translation: AAH45634.2. |
| IPI | IPI00001562. IPI00219338. IPI00640025. IPI00974296. |
| RefSeq | NP_001156736.1. NM_001163264.1. NP_001156737.1. NM_001163265.1. NP_004836.2. NM_004845.4. |
| UniGene | Hs.660708. |
3D structure databases | |
| ProteinModelPortal | Q9Y5K3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000368439. |
PTM databases | |
| PhosphoSite | Q9Y5K3. |
Polymorphism databases | |
| DMDM | 12643330. |
Proteomic databases | |
| PaxDb | Q9Y5K3. |
| PRIDE | Q9Y5K3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000356768; ENSP00000349211; ENSG00000102230. ENST00000379144; ENSP00000368439; ENSG00000102230. ENST00000379145; ENSP00000368440; ENSG00000102230. |
| GeneID | 9468. |
| KEGG | hsa:9468. |
| UCSC | uc004dbi.3. human. uc004dbk.4. human. |
Organism-specific databases | |
| CTD | 9468. |
| GeneCards | GC0XM024486. |
| HGNC | HGNC:8755. PCYT1B. |
| HPA | HPA006367. |
| MIM | 604926. gene. |
| neXtProt | NX_Q9Y5K3. |
| PharmGKB | PA33100. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0615. |
| HOGENOM | HOG000230945. |
| HOVERGEN | HBG053531. |
| InParanoid | Q9Y5K3. |
| KO | K00968. |
| OMA | EELEHTC. |
| OrthoDB | EOG45X7WJ. |
| PhylomeDB | Q9Y5K3. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. |
| UniPathway | UPA00753; UER00739. |
Gene expression databases | |
| ArrayExpress | Q9Y5K3. |
| Bgee | Q9Y5K3. |
| CleanEx | HS_PCYT1B. |
| Genevestigator | Q9Y5K3. |
| GermOnline | ENSG00000102230. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.50.620. 1 hit. |
| InterPro | IPR004821. Cyt_trans-like. IPR014729. Rossmann-like_a/b/a_fold. [Graphical view] |
| Pfam | PF01467. CTP_transf_2. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR00125. cyt_tran_rel. 1 hit. |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00122. Choline. |
| GenomeRNAi | 9468. |
| NextBio | 35472668. |
| SOURCE | Search... |
Entry information
| Entry name | PCY1B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y5K3 Secondary accession number(s): A8IX00 Q86XC9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
