Q9Y5K3 (PCY1B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Choline-phosphate cytidylyltransferase B EC=2.7.7.15 Alternative name(s): CCT-beta CTP:phosphocholine cytidylyltransferase B Short name=CCT B Short name=CT B Phosphorylcholine transferase B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 369 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Controls phosphatidylcholine synthesis. |
| Catalytic activity | CTP + choline phosphate = diphosphate + CDP-choline. |
| Pathway | |
| Subcellular location | |
| Tissue specificity | Highly expressed in testis, placenta, brain, ovary and fetus. |
| Post-translational modification | Extensively phosphorylated. The beta-1 isoform seems to be much less phosphorylated. Ref.7 Ref.8 |
| Sequence similarities | Belongs to the cytidylyltransferase family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Phospholipid biosynthesis |
| Cellular component | Endoplasmic reticulum |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Nucleotidyltransferase Transferase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | endoplasmic reticulum Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | choline-phosphate cytidylyltransferase activity Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Named isoforms=2. | ||||||
| Isoform 2 (identifier: Q9Y5K3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q9Y5K3-2) The sequence of this isoform differs from the canonical sequence as follows: 321-369: VSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK → LKSWARCRDF | ||||||
| Isoform 3 (identifier: Q9Y5K3-3) The sequence of this isoform differs from the canonical sequence as follows: 1-16: Missing. 17-39: SLSNEPPSETMEEIEHTCPQPRL → MVGNQECIMEEDNRAPQLWRK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 369 | 369 | Choline-phosphate cytidylyltransferase B | PRO_0000208456 | |||||
Regions | |||||||||
| Region | 74 – 235 | 162 | Catalytic Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 233 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 315 | 1 | Phosphoserine Ref.7 Ref.8 | ||||||
| Modified residue | 319 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 325 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 16 | 16 | Missing in isoform 3. | VSP_020045 | |||||
| Alternative sequence | 17 – 39 | 23 | SLSNE…PQPRL → MVGNQECIMEEDNRAPQLWR K in isoform 3. | VSP_020046 | |||||
| Alternative sequence | 321 – 369 | 49 | VSSPT…DEDEK → LKSWARCRDF in isoform 1. | VSP_001226 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a second human CTP:phosphocholine cytidylyltransferase." Lykidis A., Murti K.G., Jackowski S. J. Biol. Chem. 273:14022-14029(1998) [PubMed: 9593753] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Distribution of CTP:phosphocholine cytidylyltransferase (CCT) isoforms. Identification of a new CCTbeta splice variant." Lykidis A., Baburina I., Jackowski S. J. Biol. Chem. 274:26992-27001(1999) [PubMed: 10480912] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHARACTERIZATION. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Hippocampus. |
| [4] | SeattleSNPs variation discovery resource Submitted (SEP-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Brain. |
| [7] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-315, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-233 AND SER-315, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF052510 mRNA. Translation: AAC39754.1. AF148464 mRNA. Translation: AAD35088.1. AK315323 mRNA. Translation: BAG37725.1. EU181262 Genomic DNA. Translation: ABW03924.1. CH471074 Genomic DNA. Translation: EAW99021.1. BC045634 mRNA. Translation: AAH45634.2. |
| IPI | IPI00001562. IPI00219338. IPI00640025. |
| RefSeq | NP_001156736.1. NM_001163264.1. NP_001156737.1. NM_001163265.1. NP_004836.2. NM_004845.4. |
| UniGene | Hs.660708. |
3D structure databases | |
| ProteinModelPortal | Q9Y5K3. |
| SMR | Q9Y5K3. Positions 41-216, 236-268. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9Y5K3. |
PTM databases | |
| PhosphoSite | Q9Y5K3. |
Polymorphism databases | |
| DMDM | 12643330. |
Proteomic databases | |
| PRIDE | Q9Y5K3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000379144; ENSP00000368439; ENSG00000102230. |
| GeneID | 9468. |
| KEGG | hsa:9468. |
| UCSC | uc004dbi.1. human. uc004dbk.2. human. |
Organism-specific databases | |
| CTD | 9468. |
| GeneCards | GC0XM024486. |
| H-InvDB | HIX0016708. |
| HGNC | HGNC:8755. PCYT1B. |
| HPA | HPA006367. |
| MIM | 604926. gene. |
| neXtProt | NX_Q9Y5K3. |
| PharmGKB | PA33100. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG13522. |
| GeneTree | ENSGT00390000000269. |
| HOGENOM | HBG587468. |
| HOVERGEN | HBG053531. |
| InParanoid | Q9Y5K3. |
| OMA | CRAPHEK. |
| OrthoDB | EOG45X7WJ. |
| PhylomeDB | Q9Y5K3. |
Gene expression databases | |
| ArrayExpress | Q9Y5K3. |
| Bgee | Q9Y5K3. |
| CleanEx | HS_PCYT1B. |
| Genevestigator | Q9Y5K3. |
| GermOnline | ENSG00000102230. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004821. Cyt_trans-rel. IPR004820. Cytidylyltransf. IPR014729. Rossmann-like_a/b/a_fold. [Graphical view] |
| Gene3D | G3DSA:3.40.50.620. Rossmann-like_a/b/a_fold. 1 hit. |
| KO | K00968. |
| Pfam | PF01467. CTP_transf_2. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR00125. Cyt_tran_rel. 1 hit. |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00122. Choline. |
| NextBio | 35482. |
| SOURCE | Search... |
Entry information
| Entry name | PCY1B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y5K3 Secondary accession number(s): A8IX00 Q86XC9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with