Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y5K3

- PCY1B_HUMAN

UniProt

Q9Y5K3 - PCY1B_HUMAN

Protein

Choline-phosphate cytidylyltransferase B

Gene

PCYT1B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 1 (01 Nov 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Controls phosphatidylcholine synthesis.

    Catalytic activityi

    CTP + phosphocholine = diphosphate + CDP-choline.

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei122 – 1221CTPBy similarity
    Binding sitei122 – 1221SubstrateBy similarity
    Binding sitei151 – 1511SubstrateBy similarity
    Binding sitei173 – 1731CTPBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi84 – 929CTPBy similarity
    Nucleotide bindingi168 – 1692CTPBy similarity
    Nucleotide bindingi196 – 2005CTPBy similarity

    GO - Molecular functioni

    1. choline-phosphate cytidylyltransferase activity Source: ProtInc

    GO - Biological processi

    1. CDP-choline pathway Source: GOC
    2. glycerophospholipid biosynthetic process Source: Reactome
    3. ovarian follicle development Source: Ensembl
    4. phosphatidylcholine biosynthetic process Source: Reactome
    5. phospholipid metabolic process Source: Reactome
    6. small molecule metabolic process Source: Reactome
    7. spermatogenesis Source: Ensembl

    Keywords - Molecular functioni

    Nucleotidyltransferase, Transferase

    Keywords - Biological processi

    Lipid biosynthesis, Lipid metabolism, Phospholipid biosynthesis, Phospholipid metabolism

    Enzyme and pathway databases

    ReactomeiREACT_121238. Synthesis of PC.
    UniPathwayiUPA00753; UER00739.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Choline-phosphate cytidylyltransferase B (EC:2.7.7.15)
    Alternative name(s):
    CCT-beta
    CTP:phosphocholine cytidylyltransferase B
    Short name:
    CCT B
    Short name:
    CT B
    Phosphorylcholine transferase B
    Gene namesi
    Name:PCYT1B
    Synonyms:CCTB
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:8755. PCYT1B.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: ProtInc
    2. endoplasmic reticulum membrane Source: Reactome

    Keywords - Cellular componenti

    Endoplasmic reticulum

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33100.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 369369Choline-phosphate cytidylyltransferase BPRO_0000208456Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei315 – 3151Phosphoserine1 Publication
    Modified residuei319 – 3191Phosphoserine1 Publication
    Modified residuei362 – 3621Phosphoserine1 Publication

    Post-translational modificationi

    Extensively phosphorylated. The beta-1 isoform seems to be much less phosphorylated.1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9Y5K3.
    PaxDbiQ9Y5K3.
    PRIDEiQ9Y5K3.

    PTM databases

    PhosphoSiteiQ9Y5K3.

    Expressioni

    Tissue specificityi

    Highly expressed in testis, placenta, brain, ovary and fetus.

    Gene expression databases

    ArrayExpressiQ9Y5K3.
    BgeeiQ9Y5K3.
    CleanExiHS_PCYT1B.
    GenevestigatoriQ9Y5K3.

    Organism-specific databases

    HPAiHPA006367.

    Interactioni

    Protein-protein interaction databases

    BioGridi114854. 7 interactions.
    MINTiMINT-5006746.
    STRINGi9606.ENSP00000368439.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Y5K3.
    SMRiQ9Y5K3. Positions 41-295.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the cytidylyltransferase family.Curated

    Phylogenomic databases

    eggNOGiCOG0615.
    HOGENOMiHOG000230945.
    HOVERGENiHBG053531.
    InParanoidiQ9Y5K3.
    KOiK00968.
    OMAiLEHTCPH.
    OrthoDBiEOG7X9G6S.
    PhylomeDBiQ9Y5K3.
    TreeFamiTF106336.

    Family and domain databases

    Gene3Di3.40.50.620. 1 hit.
    InterProiIPR004821. Cyt_trans-like.
    IPR014729. Rossmann-like_a/b/a_fold.
    [Graphical view]
    PfamiPF01467. CTP_transf_2. 1 hit.
    [Graphical view]
    TIGRFAMsiTIGR00125. cyt_tran_rel. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 2 (identifier: Q9Y5K3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPVVTTDAES ETGIPKSLSN EPPSETMEEI EHTCPQPRLT LTAPAPFADE    50
    TNCQCQAPHE KLTIAQARLG TPADRPVRVY ADGIFDLFHS GHARALMQAK 100
    TLFPNSYLLV GVCSDDLTHK FKGFTVMNEA ERYEALRHCR YVDEVIRDAP 150
    WTLTPEFLEK HKIDFVAHDD IPYSSAGSDD VYKHIKEAGM FVPTQRTEGI 200
    STSDIITRIV RDYDVYARRN LQRGYTAKEL NVSFINEKRY RFQNQVDKMK 250
    EKVKNVEERS KEFVNRVEEK SHDLIQKWEE KSREFIGNFL ELFGPDGAWK 300
    QMFQERSSRM LQALSPKQSP VSSPTRSRSP SRSPSPTFSW LPLKTSPPSS 350
    PKAASASISS MSEGDEDEK 369
    Length:369
    Mass (Da):41,940
    Last modified:November 1, 1999 - v1
    Checksum:i87A00617DF690DD1
    GO
    Isoform 1 (identifier: Q9Y5K3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         321-369: VSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK → LKSWARCRDF

    Show »
    Length:330
    Mass (Da):38,086
    Checksum:iC1A16BC1B61906B2
    GO
    Isoform 3 (identifier: Q9Y5K3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-16: Missing.
         17-39: SLSNEPPSETMEEIEHTCPQPRL → MVGNQECIMEEDNRAPQLWRK

    Note: No experimental confirmation available.

    Show »
    Length:351
    Mass (Da):40,206
    Checksum:i0E2BBEDD2569EAA8
    GO
    Isoform 4 (identifier: Q9Y5K3-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-39: MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRL → MVGHQECIMEEDNRAPQLWRK

    Note: No experimental confirmation available.

    Show »
    Length:351
    Mass (Da):40,229
    Checksum:i89BA4A3D7F09B353
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti154 – 1541T → S in BAG59022. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3939MPVVT…PQPRL → MVGHQECIMEEDNRAPQLWR K in isoform 4. 1 PublicationVSP_044659Add
    BLAST
    Alternative sequencei1 – 1616Missing in isoform 3. 1 PublicationVSP_020045Add
    BLAST
    Alternative sequencei17 – 3923SLSNE…PQPRL → MVGNQECIMEEDNRAPQLWR K in isoform 3. 1 PublicationVSP_020046Add
    BLAST
    Alternative sequencei321 – 36949VSSPT…DEDEK → LKSWARCRDF in isoform 1. 1 PublicationVSP_001226Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF052510 mRNA. Translation: AAC39754.1.
    AF148464 mRNA. Translation: AAD35088.1.
    AK296333 mRNA. Translation: BAG59022.1.
    AK315323 mRNA. Translation: BAG37725.1.
    EU181262 Genomic DNA. Translation: ABW03924.1.
    AC079168 Genomic DNA. No translation available.
    CH471074 Genomic DNA. Translation: EAW99021.1.
    BC045634 mRNA. Translation: AAH45634.2.
    CCDSiCCDS14213.1. [Q9Y5K3-1]
    CCDS55391.1. [Q9Y5K3-2]
    CCDS55392.1. [Q9Y5K3-4]
    RefSeqiNP_001156736.1. NM_001163264.1. [Q9Y5K3-4]
    NP_001156737.1. NM_001163265.1. [Q9Y5K3-2]
    NP_004836.2. NM_004845.4. [Q9Y5K3-1]
    UniGeneiHs.660708.

    Genome annotation databases

    EnsembliENST00000356768; ENSP00000349211; ENSG00000102230. [Q9Y5K3-2]
    ENST00000379144; ENSP00000368439; ENSG00000102230. [Q9Y5K3-1]
    ENST00000379145; ENSP00000368440; ENSG00000102230. [Q9Y5K3-4]
    GeneIDi9468.
    KEGGihsa:9468.
    UCSCiuc004dbi.3. human. [Q9Y5K3-1]
    uc004dbk.4. human. [Q9Y5K3-2]

    Polymorphism databases

    DMDMi12643330.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    SeattleSNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF052510 mRNA. Translation: AAC39754.1 .
    AF148464 mRNA. Translation: AAD35088.1 .
    AK296333 mRNA. Translation: BAG59022.1 .
    AK315323 mRNA. Translation: BAG37725.1 .
    EU181262 Genomic DNA. Translation: ABW03924.1 .
    AC079168 Genomic DNA. No translation available.
    CH471074 Genomic DNA. Translation: EAW99021.1 .
    BC045634 mRNA. Translation: AAH45634.2 .
    CCDSi CCDS14213.1. [Q9Y5K3-1 ]
    CCDS55391.1. [Q9Y5K3-2 ]
    CCDS55392.1. [Q9Y5K3-4 ]
    RefSeqi NP_001156736.1. NM_001163264.1. [Q9Y5K3-4 ]
    NP_001156737.1. NM_001163265.1. [Q9Y5K3-2 ]
    NP_004836.2. NM_004845.4. [Q9Y5K3-1 ]
    UniGenei Hs.660708.

    3D structure databases

    ProteinModelPortali Q9Y5K3.
    SMRi Q9Y5K3. Positions 41-295.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114854. 7 interactions.
    MINTi MINT-5006746.
    STRINGi 9606.ENSP00000368439.

    Chemistry

    DrugBanki DB00122. Choline.

    PTM databases

    PhosphoSitei Q9Y5K3.

    Polymorphism databases

    DMDMi 12643330.

    Proteomic databases

    MaxQBi Q9Y5K3.
    PaxDbi Q9Y5K3.
    PRIDEi Q9Y5K3.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000356768 ; ENSP00000349211 ; ENSG00000102230 . [Q9Y5K3-2 ]
    ENST00000379144 ; ENSP00000368439 ; ENSG00000102230 . [Q9Y5K3-1 ]
    ENST00000379145 ; ENSP00000368440 ; ENSG00000102230 . [Q9Y5K3-4 ]
    GeneIDi 9468.
    KEGGi hsa:9468.
    UCSCi uc004dbi.3. human. [Q9Y5K3-1 ]
    uc004dbk.4. human. [Q9Y5K3-2 ]

    Organism-specific databases

    CTDi 9468.
    GeneCardsi GC0XM024576.
    HGNCi HGNC:8755. PCYT1B.
    HPAi HPA006367.
    MIMi 604926. gene.
    neXtProti NX_Q9Y5K3.
    PharmGKBi PA33100.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0615.
    HOGENOMi HOG000230945.
    HOVERGENi HBG053531.
    InParanoidi Q9Y5K3.
    KOi K00968.
    OMAi LEHTCPH.
    OrthoDBi EOG7X9G6S.
    PhylomeDBi Q9Y5K3.
    TreeFami TF106336.

    Enzyme and pathway databases

    UniPathwayi UPA00753 ; UER00739 .
    Reactomei REACT_121238. Synthesis of PC.

    Miscellaneous databases

    GeneWikii PCYT1B.
    GenomeRNAii 9468.
    NextBioi 35472668.
    PROi Q9Y5K3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9Y5K3.
    Bgeei Q9Y5K3.
    CleanExi HS_PCYT1B.
    Genevestigatori Q9Y5K3.

    Family and domain databases

    Gene3Di 3.40.50.620. 1 hit.
    InterProi IPR004821. Cyt_trans-like.
    IPR014729. Rossmann-like_a/b/a_fold.
    [Graphical view ]
    Pfami PF01467. CTP_transf_2. 1 hit.
    [Graphical view ]
    TIGRFAMsi TIGR00125. cyt_tran_rel. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of a second human CTP:phosphocholine cytidylyltransferase."
      Lykidis A., Murti K.G., Jackowski S.
      J. Biol. Chem. 273:14022-14029(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Distribution of CTP:phosphocholine cytidylyltransferase (CCT) isoforms. Identification of a new CCTbeta splice variant."
      Lykidis A., Baburina I., Jackowski S.
      J. Biol. Chem. 274:26992-27001(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHARACTERIZATION.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
      Tissue: Hippocampus and Thalamus.
    4. SeattleSNPs variation discovery resource
      Submitted (SEP-2007) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    5. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Brain.
    8. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-315; SER-319 AND SER-362, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiPCY1B_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y5K3
    Secondary accession number(s): A8IX00
    , B2RCX8, B4DK10, E9PD84, O60621, Q86XC9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 24, 2001
    Last sequence update: November 1, 1999
    Last modified: October 1, 2014
    This is version 120 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3