Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Choline-phosphate cytidylyltransferase B

Gene

PCYT1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Controls phosphatidylcholine synthesis.

Catalytic activityi

CTP + phosphocholine = diphosphate + CDP-choline.By similarity

Pathwayi: phosphatidylcholine biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes phosphatidylcholine from phosphocholine.By similarity
Proteins known to be involved in the 2 steps of the subpathway in this organism are:
  1. Choline-phosphate cytidylyltransferase A (PCYT1A), Choline-phosphate cytidylyltransferase B (PCYT1B)
  2. Cholinephosphotransferase 1 (CHPT1), Choline/ethanolaminephosphotransferase 1 (CEPT1)
This subpathway is part of the pathway phosphatidylcholine biosynthesis, which is itself part of Phospholipid metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes phosphatidylcholine from phosphocholine, the pathway phosphatidylcholine biosynthesis and in Phospholipid metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei122CTPBy similarity1
Binding sitei122SubstrateBy similarity1
Binding sitei151SubstrateBy similarity1
Binding sitei173CTPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi84 – 92CTPBy similarity9
Nucleotide bindingi168 – 169CTPBy similarity2
Nucleotide bindingi196 – 200CTPBy similarity5

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionNucleotidyltransferase, Transferase
Biological processLipid biosynthesis, Lipid metabolism, Phospholipid biosynthesis, Phospholipid metabolism

Enzyme and pathway databases

ReactomeiR-HSA-1483191 Synthesis of PC
UniPathwayiUPA00753; UER00739

Chemistry databases

SwissLipidsiSLP:000001754

Names & Taxonomyi

Protein namesi
Recommended name:
Choline-phosphate cytidylyltransferase B (EC:2.7.7.15By similarity)
Alternative name(s):
CCT-beta
CTP:phosphocholine cytidylyltransferase B
Short name:
CCT B
Short name:
CT B
Phosphorylcholine transferase B
Gene namesi
Name:PCYT1B
Synonyms:CCTB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000102230.13
HGNCiHGNC:8755 PCYT1B
MIMi300948 gene
neXtProtiNX_Q9Y5K3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum

Pathology & Biotechi

Organism-specific databases

DisGeNETi9468
OpenTargetsiENSG00000102230
PharmGKBiPA33100

Chemistry databases

DrugBankiDB00122 Choline

Polymorphism and mutation databases

BioMutaiPCYT1B
DMDMi12643330

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002084561 – 369Choline-phosphate cytidylyltransferase BAdd BLAST369

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei315PhosphoserineCombined sources1
Modified residuei319PhosphoserineCombined sources1
Modified residuei322PhosphoserineBy similarity1
Modified residuei323PhosphoserineBy similarity1
Modified residuei329PhosphoserineBy similarity1
Modified residuei331PhosphoserineBy similarity1
Modified residuei335PhosphoserineBy similarity1
Modified residuei345PhosphothreonineBy similarity1
Modified residuei346PhosphoserineBy similarity1
Modified residuei349PhosphoserineBy similarity1
Modified residuei350PhosphoserineBy similarity1
Modified residuei355PhosphoserineBy similarity1
Modified residuei360PhosphoserineBy similarity1
Modified residuei362PhosphoserineCombined sources1

Post-translational modificationi

Extensively phosphorylated. The beta-1 isoform seems to be much less phosphorylated.

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9Y5K3
PaxDbiQ9Y5K3
PeptideAtlasiQ9Y5K3
PRIDEiQ9Y5K3
ProteomicsDBi86427
86428 [Q9Y5K3-2]
86429 [Q9Y5K3-3]

PTM databases

iPTMnetiQ9Y5K3
PhosphoSitePlusiQ9Y5K3

Expressioni

Tissue specificityi

Highly expressed in testis, placenta, brain, ovary and fetus.

Gene expression databases

BgeeiENSG00000102230
CleanExiHS_PCYT1B
ExpressionAtlasiQ9Y5K3 baseline and differential
GenevisibleiQ9Y5K3 HS

Organism-specific databases

HPAiHPA006367

Interactioni

Subunit structurei

Homodimer.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
PCYT1AP495854EBI-12280028,EBI-2563309

Protein-protein interaction databases

BioGridi114854, 6 interactors
IntActiQ9Y5K3, 2 interactors
STRINGi9606.ENSP00000368439

Structurei

3D structure databases

ProteinModelPortaliQ9Y5K3
SMRiQ9Y5K3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cytidylyltransferase family.Curated

Phylogenomic databases

eggNOGiKOG2804 Eukaryota
COG0615 LUCA
GeneTreeiENSGT00390000000269
HOGENOMiHOG000230945
HOVERGENiHBG053531
InParanoidiQ9Y5K3
KOiK00968
OMAiLEHTCPH
OrthoDBiEOG091G0DDW
PhylomeDBiQ9Y5K3
TreeFamiTF106336

Family and domain databases

Gene3Di3.40.50.620, 1 hit
InterProiView protein in InterPro
IPR004821 Cyt_trans-like
IPR014729 Rossmann-like_a/b/a_fold
PfamiView protein in Pfam
PF01467 CTP_transf_like, 1 hit
TIGRFAMsiTIGR00125 cyt_tran_rel, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q9Y5K3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVVTTDAES ETGIPKSLSN EPPSETMEEI EHTCPQPRLT LTAPAPFADE
60 70 80 90 100
TNCQCQAPHE KLTIAQARLG TPADRPVRVY ADGIFDLFHS GHARALMQAK
110 120 130 140 150
TLFPNSYLLV GVCSDDLTHK FKGFTVMNEA ERYEALRHCR YVDEVIRDAP
160 170 180 190 200
WTLTPEFLEK HKIDFVAHDD IPYSSAGSDD VYKHIKEAGM FVPTQRTEGI
210 220 230 240 250
STSDIITRIV RDYDVYARRN LQRGYTAKEL NVSFINEKRY RFQNQVDKMK
260 270 280 290 300
EKVKNVEERS KEFVNRVEEK SHDLIQKWEE KSREFIGNFL ELFGPDGAWK
310 320 330 340 350
QMFQERSSRM LQALSPKQSP VSSPTRSRSP SRSPSPTFSW LPLKTSPPSS
360
PKAASASISS MSEGDEDEK
Length:369
Mass (Da):41,940
Last modified:November 1, 1999 - v1
Checksum:i87A00617DF690DD1
GO
Isoform 1 (identifier: Q9Y5K3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     321-369: VSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK → LKSWARCRDF

Show »
Length:330
Mass (Da):38,086
Checksum:iC1A16BC1B61906B2
GO
Isoform 3 (identifier: Q9Y5K3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: Missing.
     17-39: SLSNEPPSETMEEIEHTCPQPRL → MVGNQECIMEEDNRAPQLWRK

Note: No experimental confirmation available.
Show »
Length:351
Mass (Da):40,206
Checksum:i0E2BBEDD2569EAA8
GO
Isoform 4 (identifier: Q9Y5K3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRL → MVGHQECIMEEDNRAPQLWRK

Note: No experimental confirmation available.
Show »
Length:351
Mass (Da):40,229
Checksum:i89BA4A3D7F09B353
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti154T → S in BAG59022 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0446591 – 39MPVVT…PQPRL → MVGHQECIMEEDNRAPQLWR K in isoform 4. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_0200451 – 16Missing in isoform 3. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_02004617 – 39SLSNE…PQPRL → MVGNQECIMEEDNRAPQLWR K in isoform 3. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_001226321 – 369VSSPT…DEDEK → LKSWARCRDF in isoform 1. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF052510 mRNA Translation: AAC39754.1
AF148464 mRNA Translation: AAD35088.1
AK296333 mRNA Translation: BAG59022.1
AK315323 mRNA Translation: BAG37725.1
EU181262 Genomic DNA Translation: ABW03924.1
AC079168 Genomic DNA No translation available.
CH471074 Genomic DNA Translation: EAW99021.1
BC045634 mRNA Translation: AAH45634.2
CCDSiCCDS14213.1 [Q9Y5K3-1]
CCDS55391.1 [Q9Y5K3-2]
CCDS55392.1 [Q9Y5K3-4]
RefSeqiNP_001156736.1, NM_001163264.1 [Q9Y5K3-4]
NP_001156737.1, NM_001163265.1 [Q9Y5K3-2]
NP_004836.2, NM_004845.4 [Q9Y5K3-1]
UniGeneiHs.660708

Genome annotation databases

EnsembliENST00000356768; ENSP00000349211; ENSG00000102230 [Q9Y5K3-2]
ENST00000379144; ENSP00000368439; ENSG00000102230 [Q9Y5K3-1]
ENST00000379145; ENSP00000368440; ENSG00000102230 [Q9Y5K3-4]
GeneIDi9468
KEGGihsa:9468
UCSCiuc004dbi.4 human [Q9Y5K3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPCY1B_HUMAN
AccessioniPrimary (citable) accession number: Q9Y5K3
Secondary accession number(s): A8IX00
, B2RCX8, B4DK10, E9PD84, O60621, Q86XC9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: November 1, 1999
Last modified: June 20, 2018
This is version 145 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health