Q9Y5K1 (SPO11_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Meiotic recombination protein SPO11 Alternative name(s): Cancer/testis antigen 35 Short name=CT35 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 396 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Required for meiotic recombination. Mediates DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination By similarity. Essential for the phosphorylation of SMC3, HORMAD1 and HORMAD2 By similarity. |
| Subcellular location | Nucleus By similarity. |
| Tissue specificity | Highly expressed in testis. |
| Sequence similarities | Belongs to the TOP6A family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y5K1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y5K1-2) The sequence of this isoform differs from the canonical sequence as follows: 44-82: SSEVLASIENIIQDIITSLARNEAPAFTIDNRSSWENIK → R | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 396 | 396 | Meiotic recombination protein SPO11 | PRO_0000145474 | |||||
Sites | |||||||||
| Active site | 138 | 1 | Nucleophile By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 44 – 82 | 39 | SSEVL…WENIK → R in isoform 2. | VSP_006533 | |||||
| Natural variant | 36 | 1 | T → A. Ref.3 Corresponds to variant rs28368062 [ dbSNP | Ensembl ]. | VAR_023307 | |||||
| Natural variant | 91 | 1 | M → V. Corresponds to variant rs3736832 [ dbSNP | Ensembl ]. | VAR_052596 | |||||
| Natural variant | 202 | 1 | A → V. Corresponds to variant rs17406460 [ dbSNP | Ensembl ]. | VAR_052597 | |||||
| Natural variant | 211 | 1 | R → W. Corresponds to variant rs28368082 [ dbSNP | Ensembl ]. | VAR_029246 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Differential gene expression of mammalian SPO11/TOP6A homologs during meiosis." Shannon M., Richardson L., Christian A., Handel M.A., Thelen M.P. FEBS Lett. 462:329-334(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Testis. |
| [2] | "Cloning, characterization, and localization of mouse and human SPO11." Romanienko P.J., Camerini-Otero R.D. Genomics 61:156-169(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Testis. |
| [3] | NIEHS SNPs program Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ALA-36. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF149310 mRNA. Translation: AAD44812.1. AF169385 mRNA. Translation: AAD52562.1. AY957583 Genomic DNA. Translation: AAX44047.1. AL135939 Genomic DNA. Translation: CAI21521.1. AL135939 Genomic DNA. Translation: CAI21522.1. BC033591 mRNA. Translation: AAH33591.1. |
| IPI | IPI00181896. IPI00843905. |
| RefSeq | NP_036576.1. NM_012444.2. NP_937998.1. NM_198265.1. |
| UniGene | Hs.159737. |
3D structure databases | |
| ProteinModelPortal | Q9Y5K1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000360310. |
PTM databases | |
| PhosphoSite | Q9Y5K1. |
Polymorphism databases | |
| DMDM | 7674367. |
Proteomic databases | |
| PaxDb | Q9Y5K1. |
| PRIDE | Q9Y5K1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000345868; ENSP00000316034; ENSG00000054796. ENST00000371263; ENSP00000360310; ENSG00000054796. |
| GeneID | 23626. |
| KEGG | hsa:23626. |
| UCSC | uc002xye.3. human. uc002xyf.3. human. |
Organism-specific databases | |
| CTD | 23626. |
| GeneCards | GC20P055905. |
| HGNC | HGNC:11250. SPO11. |
| MIM | 605114. gene. |
| neXtProt | NX_Q9Y5K1. |
| PharmGKB | PA36080. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1697. |
| HOGENOM | HOG000225930. |
| HOVERGEN | HBG058605. |
| KO | K10878. |
| OMA | CTTRKIK. |
| OrthoDB | EOG44J2J4. |
| PhylomeDB | Q9Y5K1. |
Enzyme and pathway databases | |
| Reactome | REACT_111183. Meiosis. |
Gene expression databases | |
| ArrayExpress | Q9Y5K1. |
| Bgee | Q9Y5K1. |
| CleanEx | HS_SPO11. |
| Genevestigator | Q9Y5K1. |
| GermOnline | ENSG00000054796. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.10.10. 1 hit. |
| InterPro | IPR004084. Meiosis_Spo11. IPR013048. Meiotic_Spo11. IPR002815. Spo11/TopoVI_A. IPR013049. Spo11/TopoVI_A_N. IPR011991. WHTH_DNA-bd_dom. [Graphical view] |
| PANTHER | PTHR10848. PTHR10848. 1 hit. |
| Pfam | PF03533. SPO11_like. 1 hit. PF04406. TP6A_N. 1 hit. [Graphical view] |
| PRINTS | PR01551. SPO11HOMOLOG. PR01550. TOP6AFAMILY. |
| SUPFAM | SSF56726. Spo11/TopoVI_A. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 23626. |
| NextBio | 46390. |
| SOURCE | Search... |
Entry information
| Entry name | SPO11_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y5K1 Secondary accession number(s): Q5TCI1 Q9NQM8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
