Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Y5K1 (SPO11_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 119. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Meiotic recombination protein SPO11
Alternative name(s):
Cancer/testis antigen 35
Short name=CT35
Gene names
Name:SPO11
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length396 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Required for meiotic recombination. Mediates DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination By similarity. Essential for the phosphorylation of SMC3, HORMAD1 and HORMAD2 By similarity.

Subcellular location

Nucleus By similarity.

Tissue specificity

Highly expressed in testis.

Sequence similarities

Belongs to the TOP6A family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9Y5K1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9Y5K1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     44-82: SSEVLASIENIIQDIITSLARNEAPAFTIDNRSSWENIK → R
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 396396Meiotic recombination protein SPO11
PRO_0000145474

Sites

Active site1381Nucleophile By similarity

Natural variations

Alternative sequence44 – 8239SSEVL…WENIK → R in isoform 2.
VSP_006533
Natural variant361T → A. Ref.3
Corresponds to variant rs28368062 [ dbSNP | Ensembl ].
VAR_023307
Natural variant911M → V.
Corresponds to variant rs3736832 [ dbSNP | Ensembl ].
VAR_052596
Natural variant2021A → V.
Corresponds to variant rs17406460 [ dbSNP | Ensembl ].
VAR_052597
Natural variant2111R → W.
Corresponds to variant rs28368082 [ dbSNP | Ensembl ].
VAR_029246

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1999. Version 1.
Checksum: 117A93D1E7BEBEC8

FASTA39644,537
        10         20         30         40         50         60 
MAFAPMGPEA SFFDVLDRHR ESLLAALRRG GREPPTGGSR LASSSEVLAS IENIIQDIIT 

        70         80         90        100        110        120 
SLARNEAPAF TIDNRSSWEN IKFEDSVGLQ MVSHCTTRKI KSDSPKSAQK FSLILKILSM 

       130        140        150        160        170        180 
IYKLVQSNTY ATKRDIYYTD SQLFGNQTVV DNIINDISCM LKVSRRSLHI LSTSKGLIAG 

       190        200        210        220        230        240 
NLRYIEEDGT KVNCTCGATA VAVPSNIQGI RNLVTDAKFV LIVEKDATFQ RLLDDNFCNK 

       250        260        270        280        290        300 
LSPCIMITGK GVPDLNTRLL VKKLWDTFHV PVFTLVDADP HGIEIMCIYK YGSMSMSFEA 

       310        320        330        340        350        360 
HHLTVPAIRW LGLLPSDLKR LNVPKDSLIP LTKRDQMKLD SILRRPYVTC QPFWRKEMEI 

       370        380        390 
MADSKMKAEI QALTFLSSDY LSRVYLPNKL KFGGWI 

« Hide

Isoform 2 [UniParc].

Checksum: 0277826777623625
Show »

FASTA35840,364

References

« Hide 'large scale' references
[1]"Differential gene expression of mammalian SPO11/TOP6A homologs during meiosis."
Shannon M., Richardson L., Christian A., Handel M.A., Thelen M.P.
FEBS Lett. 462:329-334(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Testis.
[2]"Cloning, characterization, and localization of mouse and human SPO11."
Romanienko P.J., Camerini-Otero R.D.
Genomics 61:156-169(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Testis.
[3]NIEHS SNPs program
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ALA-36.
[4]"The DNA sequence and comparative analysis of human chromosome 20."
Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. expand/collapse author list , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
+Additional computationally mapped references.

Web resources

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF149310 mRNA. Translation: AAD44812.1.
AF169385 mRNA. Translation: AAD52562.1.
AY957583 Genomic DNA. Translation: AAX44047.1.
AL135939 Genomic DNA. Translation: CAI21521.1.
AL135939 Genomic DNA. Translation: CAI21522.1.
BC033591 mRNA. Translation: AAH33591.1.
RefSeqNP_036576.1. NM_012444.2.
NP_937998.1. NM_198265.1.
UniGeneHs.159737.

3D structure databases

ProteinModelPortalQ9Y5K1.
SMRQ9Y5K1. Positions 43-396.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000360310.

PTM databases

PhosphoSiteQ9Y5K1.

Polymorphism databases

DMDM7674367.

Proteomic databases

PaxDbQ9Y5K1.
PRIDEQ9Y5K1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000345868; ENSP00000316034; ENSG00000054796. [Q9Y5K1-2]
ENST00000371263; ENSP00000360310; ENSG00000054796. [Q9Y5K1-1]
GeneID23626.
KEGGhsa:23626.
UCSCuc002xye.3. human. [Q9Y5K1-1]
uc002xyf.3. human. [Q9Y5K1-2]

Organism-specific databases

CTD23626.
GeneCardsGC20P055905.
HGNCHGNC:11250. SPO11.
MIM605114. gene.
neXtProtNX_Q9Y5K1.
PharmGKBPA36080.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1697.
HOGENOMHOG000225930.
HOVERGENHBG058605.
KOK10878.
OMATLREAYY.
OrthoDBEOG72ZCF6.
PhylomeDBQ9Y5K1.
TreeFamTF314157.

Enzyme and pathway databases

ReactomeREACT_111183. Meiosis.

Gene expression databases

ArrayExpressQ9Y5K1.
BgeeQ9Y5K1.
CleanExHS_SPO11.
GenevestigatorQ9Y5K1.

Family and domain databases

Gene3D1.10.10.10. 1 hit.
InterProIPR004084. Meiosis_Spo11.
IPR013048. Meiotic_Spo11.
IPR002815. Spo11/TopoVI_A.
IPR013049. Spo11/TopoVI_A_N.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PANTHERPTHR10848. PTHR10848. 1 hit.
PfamPF03533. SPO11_like. 1 hit.
PF04406. TP6A_N. 1 hit.
[Graphical view]
PRINTSPR01551. SPO11HOMOLOG.
PR01550. TOP6AFAMILY.
SUPFAMSSF56726. SSF56726. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi23626.
NextBio46390.
PROQ9Y5K1.
SOURCESearch...

Entry information

Entry nameSPO11_HUMAN
AccessionPrimary (citable) accession number: Q9Y5K1
Secondary accession number(s): Q5TCI1 expand/collapse secondary AC list , Q8N4V0, Q9NQM7, Q9NQM8
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1999
Last modified: March 19, 2014
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 20

Human chromosome 20: entries, gene names and cross-references to MIM