Q9Y5H7 (PCDA5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protocadherin alpha-5 Short name=PCDH-alpha-5 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 936 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain. |
| Subcellular location | Cell membrane; Single-pass type I membrane protein By similarity. |
| Sequence similarities | Contains 6 cadherin domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Signal Transmembrane Transmembrane helix |
| Ligand | Calcium |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell adhesion Traceable author statement Ref.1. Source: ProtInc homophilic cell adhesionInferred from electronic annotation. Source: InterPro nervous system developmentTraceable author statement Ref.1. Source: ProtInc |
| Cellular_component | integral to plasma membrane Traceable author statement Ref.1. Source: ProtInc |
| Molecular_function | calcium ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y5H7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y5H7-2) The sequence of this isoform differs from the canonical sequence as follows: 785-816: PRQPNPDWRYSASLRAGMHSSVHLEEAGILRA → VSFLILTSIFPSQFSNIKCHIHPLFLYLKIMS 817-936: Missing. | ||||||
| Isoform 3 (identifier: Q9Y5H7-3) The sequence of this isoform differs from the canonical sequence as follows: 868-890: GELPDKFIIPGSPAIISIRQEPT → EPKKQTQVSFLLRRKGEASQPRQ 891-936: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 28 | 28 | Potential | ||||||
| Chain | 29 – 936 | 908 | Protocadherin alpha-5 | PRO_0000003892 | |||||
Regions | |||||||||
| Topological domain | 29 – 696 | 668 | Extracellular Potential | ||||||
| Transmembrane | 697 – 717 | 21 | Helical; Potential | ||||||
| Topological domain | 718 – 936 | 219 | Cytoplasmic Potential | ||||||
| Domain | 33 – 132 | 100 | Cadherin 1 | ||||||
| Domain | 156 – 241 | 86 | Cadherin 2 | ||||||
| Domain | 242 – 349 | 108 | Cadherin 3 | ||||||
| Domain | 350 – 454 | 105 | Cadherin 4 | ||||||
| Domain | 455 – 564 | 110 | Cadherin 5 | ||||||
| Domain | 580 – 677 | 98 | Cadherin 6 | ||||||
| Repeat | 773 – 776 | 4 | PXXP 1 | ||||||
| Repeat | 785 – 788 | 4 | PXXP 2 | ||||||
| Repeat | 818 – 821 | 4 | PXXP 3 | ||||||
| Repeat | 873 – 876 | 4 | PXXP 4 | ||||||
| Repeat | 877 – 890 | 14 | PXXP 5 | ||||||
| Region | 773 – 890 | 118 | 5 X 4 AA repeats of P-X-X-P | ||||||
| Compositional bias | 909 – 916 | 8 | Poly-Lys | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 264 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 547 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 785 – 816 | 32 | PRQPN…GILRA → VSFLILTSIFPSQFSNIKCH IHPLFLYLKIMS in isoform 2. | VSP_000679 | |||||
| Alternative sequence | 817 – 936 | 120 | Missing in isoform 2. | VSP_000680 | |||||
| Alternative sequence | 868 – 890 | 23 | GELPD…RQEPT → EPKKQTQVSFLLRRKGEASQ PRQ in isoform 3. | VSP_008704 | |||||
| Alternative sequence | 891 – 936 | 46 | Missing in isoform 3. | VSP_008705 | |||||
| Natural variant | 691 | 1 | A → V. Corresponds to variant rs4141841 [ dbSNP | Ensembl ]. | VAR_048526 | |||||
Experimental info | |||||||||
| Sequence conflict | 237 | 1 | N → S in AAH33735. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A striking organization of a large family of human neural cadherin-like cell adhesion genes." Wu Q., Maniatis T. Cell 97:779-790(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Brain. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Brain and Lung. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF152313 mRNA. Translation: AAD43707.1. AF152483 mRNA. Translation: AAD43744.1. AC005609 Genomic DNA. Translation: AAC34321.1. BC033735 mRNA. Translation: AAH33735.1. |
| IPI | IPI00001496. IPI00221113. IPI00377226. |
| RefSeq | NP_061731.1. NM_018908.2. NP_113689.1. NM_031501.1. |
| UniGene | Hs.199343. |
3D structure databases | |
| ProteinModelPortal | Q9Y5H7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9Y5H7. 1 interaction. |
| MINT | MINT-7242520. |
PTM databases | |
| PhosphoSite | Q9Y5H7. |
Polymorphism databases | |
| DMDM | 13878428. |
Proteomic databases | |
| PaxDb | Q9Y5H7. |
| PRIDE | Q9Y5H7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000378126; ENSP00000367366; ENSG00000204965. ENST00000529619; ENSP00000433416; ENSG00000204965. ENST00000529859; ENSP00000436557; ENSG00000204965. |
| GeneID | 56143. |
| KEGG | hsa:56143. |
| UCSC | uc003lhj.1. human. uc003lhk.1. human. uc003lhl.2. human. |
Organism-specific databases | |
| CTD | 56143. |
| GeneCards | GC05P140405. |
| H-InvDB | HIX0164437. |
| HGNC | HGNC:8671. PCDHA5. |
| HPA | HPA008712. HPA044557. |
| MIM | 604966. gene. 606311. gene. |
| neXtProt | NX_Q9Y5H7. |
| PharmGKB | PA33017. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG294765. |
| HOGENOM | HOG000220892. |
| HOVERGEN | HBG054878. |
| InParanoid | Q9Y5H7. |
| KO | K16493. |
| OMA | SLFLPVK. |
| OrthoDB | EOG4QVCBC. |
Gene expression databases | |
| Bgee | Q9Y5H7. |
| Genevestigator | Q9Y5H7. |
| GermOnline | ENSG00000204965. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.60. 6 hits. |
| InterPro | IPR002126. Cadherin. IPR015919. Cadherin-like. IPR020894. Cadherin_CS. IPR013164. Cadherin_N. [Graphical view] |
| Pfam | PF00028. Cadherin. 5 hits. PF08266. Cadherin_2. 1 hit. [Graphical view] |
| PRINTS | PR00205. CADHERIN. |
| SMART | SM00112. CA. 6 hits. [Graphical view] |
| SUPFAM | SSF49313. Cadherin. 6 hits. |
| PROSITE | PS00232. CADHERIN_1. 5 hits. PS50268. CADHERIN_2. 6 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 56143. |
| NextBio | 61726. |
| SOURCE | Search... |
Entry information
| Entry name | PCDA5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y5H7 Secondary accession number(s): O75284, Q8N4R3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
