Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protocadherin alpha-5

Gene

PCDHA5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.

GO - Molecular functioni

GO - Biological processi

  • cell adhesion Source: ProtInc
  • homophilic cell adhesion via plasma membrane adhesion molecules Source: InterPro
  • nervous system development Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Protocadherin alpha-5
Short name:
PCDH-alpha-5
Gene namesi
Name:PCDHA5
Synonyms:CNRS6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:8671. PCDHA5.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini29 – 696668ExtracellularSequence analysisAdd
BLAST
Transmembranei697 – 71721HelicalSequence analysisAdd
BLAST
Topological domaini718 – 936219CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • integral component of plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33017.

Polymorphism and mutation databases

BioMutaiPCDHA5.
DMDMi13878428.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2828Sequence analysisAdd
BLAST
Chaini29 – 936908Protocadherin alpha-5PRO_0000003892Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi264 – 2641N-linked (GlcNAc...)Sequence analysis
Glycosylationi547 – 5471N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9Y5H7.
PeptideAtlasiQ9Y5H7.
PRIDEiQ9Y5H7.

PTM databases

iPTMnetiQ9Y5H7.
PhosphoSiteiQ9Y5H7.

Expressioni

Gene expression databases

BgeeiENSG00000204965.
GenevisibleiQ9Y5H7. HS.

Organism-specific databases

HPAiHPA044557.

Interactioni

Protein-protein interaction databases

BioGridi121083. 1 interaction.
IntActiQ9Y5H7. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ9Y5H7.
SMRiQ9Y5H7. Positions 26-668.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini33 – 132100Cadherin 1PROSITE-ProRule annotationAdd
BLAST
Domaini156 – 24186Cadherin 2PROSITE-ProRule annotationAdd
BLAST
Domaini242 – 349108Cadherin 3PROSITE-ProRule annotationAdd
BLAST
Domaini350 – 454105Cadherin 4PROSITE-ProRule annotationAdd
BLAST
Domaini455 – 564110Cadherin 5PROSITE-ProRule annotationAdd
BLAST
Domaini580 – 67798Cadherin 6PROSITE-ProRule annotationAdd
BLAST
Repeati773 – 7764PXXP 1
Repeati785 – 7884PXXP 2
Repeati818 – 8214PXXP 3
Repeati873 – 8764PXXP 4
Repeati877 – 89014PXXP 5Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni773 – 8901185 X 4 AA repeats of P-X-X-PAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi909 – 9168Poly-Lys

Sequence similaritiesi

Contains 6 cadherin domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3594. Eukaryota.
ENOG410XQHI. LUCA.
GeneTreeiENSGT00840000129695.
HOGENOMiHOG000220892.
HOVERGENiHBG054878.
InParanoidiQ9Y5H7.
KOiK16493.
OMAiCRRRAEC.
OrthoDBiEOG091G00KR.
PhylomeDBiQ9Y5H7.
TreeFamiTF332299.

Family and domain databases

Gene3Di2.60.40.60. 6 hits.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR031904. Cadherin_CBD.
IPR020894. Cadherin_CS.
IPR013164. Cadherin_N.
[Graphical view]
PfamiPF00028. Cadherin. 5 hits.
PF08266. Cadherin_2. 1 hit.
PF15974. Cadherin_tail. 1 hit.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 6 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 6 hits.
PROSITEiPS00232. CADHERIN_1. 5 hits.
PS50268. CADHERIN_2. 6 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y5H7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVYSRRGSLG SRLLLLWLLL AYWKAGSGQL HYSIPEEAKH GTFVGRIAQD
60 70 80 90 100
LGLELAELVP RLFRVASKGR GDLLEVNLQN GILFVNSRID REELCRRRAE
110 120 130 140 150
CSIHLEVIVD RPLQVFHVEV AVKDINDNPP RFSRQEQRLF ILESRMPDSR
160 170 180 190 200
FPLEGASDLD IGANAQLRYR LNPNEYFDLD VKTNEEETNF LELVLRKSLD
210 220 230 240 250
REETQEHRLL VIATDGGKPE LTGTVQLLIN VLDANDNAPE FDKSIYNVRL
260 270 280 290 300
LENAPSGTLV IKLNASDADE GINKEIVYFF SNLVLDDVKS KFIINSNTGE
310 320 330 340 350
IKVNGELDYE DYNSYEINID AMDKSTFPLS GHCKVVVKLL DVNDNTPEMA
360 370 380 390 400
ITTLFLPVKE DAPLSTVIAL ISVSDRDSGA NGQVTCSLMP HVPFKLVSTF
410 420 430 440 450
KNYYSLVLDS ALDRESVSVY ELVVTARDGG SPSLWATASV SVEVADVNDN
460 470 480 490 500
APAFAQPQYT VFVKENNPPG CHIFTVSARD ADAQENALVS YSLVERRVGE
510 520 530 540 550
RPLSSYVSVH AESGKVYALQ PLDHEEVELL QFQVSARDAG VPPLGSNVTL
560 570 580 590 600
QVFVLDENDN APALLVPRVG GTGGAVSELV PRSVGAGHVV AKVRAVDPDS
610 620 630 640 650
GYNAWLSYEL QPAPGSARIP FRVGLYTGEI STTRSLDETE APRHRLLVLV
660 670 680 690 700
KDHGEPPLTA TATVLVSLVE SGQAPKASSR ASAGAVGPEA ALVDVNVYLI
710 720 730 740 750
IAICAVSSLL VLTLLLYTAL RCSAQPTEAV CTRGKPTLLC SSAVGSWSYS
760 770 780 790 800
QQRRQRVCSG EAPPKTDLMA FSPSLPQGPT STDNPRQPNP DWRYSASLRA
810 820 830 840 850
GMHSSVHLEE AGILRAGPGG PDQQWPTVSS ATPEPEAGEV SPPVGAGVNS
860 870 880 890 900
NSWTFKYGPG NPKQSGPGEL PDKFIIPGSP AIISIRQEPT NSQIDKSDFI
910 920 930
TFGKKEETKK KKKKKKGNKT QEKKEKGNST TDNSDQ
Length:936
Mass (Da):102,048
Last modified:November 1, 1999 - v1
Checksum:i7143EECE1A357CD6
GO
Isoform 2 (identifier: Q9Y5H7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     785-816: PRQPNPDWRYSASLRAGMHSSVHLEEAGILRA → VSFLILTSIFPSQFSNIKCHIHPLFLYLKIMS
     817-936: Missing.

Show »
Length:816
Mass (Da):89,349
Checksum:i3866970F5657BF16
GO
Isoform 3 (identifier: Q9Y5H7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     868-890: GELPDKFIIPGSPAIISIRQEPT → EPKKQTQVSFLLRRKGEASQPRQ
     891-936: Missing.

Note: No experimental confirmation available.
Show »
Length:890
Mass (Da):96,996
Checksum:iFD9B5EA33572A7E3
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti237 – 2371N → S in AAH33735 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti691 – 6911A → V.
Corresponds to variant rs4141841 [ dbSNP | Ensembl ].
VAR_048526

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei785 – 81632PRQPN…GILRA → VSFLILTSIFPSQFSNIKCH IHPLFLYLKIMS in isoform 2. 1 PublicationVSP_000679Add
BLAST
Alternative sequencei817 – 936120Missing in isoform 2. 1 PublicationVSP_000680Add
BLAST
Alternative sequencei868 – 89023GELPD…RQEPT → EPKKQTQVSFLLRRKGEASQ PRQ in isoform 3. 1 PublicationVSP_008704Add
BLAST
Alternative sequencei891 – 93646Missing in isoform 3. 1 PublicationVSP_008705Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF152313 mRNA. Translation: AAD43707.1.
AF152483 mRNA. Translation: AAD43744.1.
AC005609 Genomic DNA. Translation: AAC34321.1.
BC033735 mRNA. Translation: AAH33735.1.
CCDSiCCDS54917.1. [Q9Y5H7-1]
RefSeqiNP_061731.1. NM_018908.2. [Q9Y5H7-1]
NP_113689.1. NM_031501.1. [Q9Y5H7-2]
UniGeneiHs.199343.

Genome annotation databases

EnsembliENST00000529619; ENSP00000433416; ENSG00000204965. [Q9Y5H7-3]
ENST00000529859; ENSP00000436557; ENSG00000204965. [Q9Y5H7-1]
ENST00000614258; ENSP00000484128; ENSG00000204965. [Q9Y5H7-2]
GeneIDi56143.
KEGGihsa:56143.
UCSCiuc003lhj.2. human. [Q9Y5H7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF152313 mRNA. Translation: AAD43707.1.
AF152483 mRNA. Translation: AAD43744.1.
AC005609 Genomic DNA. Translation: AAC34321.1.
BC033735 mRNA. Translation: AAH33735.1.
CCDSiCCDS54917.1. [Q9Y5H7-1]
RefSeqiNP_061731.1. NM_018908.2. [Q9Y5H7-1]
NP_113689.1. NM_031501.1. [Q9Y5H7-2]
UniGeneiHs.199343.

3D structure databases

ProteinModelPortaliQ9Y5H7.
SMRiQ9Y5H7. Positions 26-668.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121083. 1 interaction.
IntActiQ9Y5H7. 1 interaction.

PTM databases

iPTMnetiQ9Y5H7.
PhosphoSiteiQ9Y5H7.

Polymorphism and mutation databases

BioMutaiPCDHA5.
DMDMi13878428.

Proteomic databases

PaxDbiQ9Y5H7.
PeptideAtlasiQ9Y5H7.
PRIDEiQ9Y5H7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000529619; ENSP00000433416; ENSG00000204965. [Q9Y5H7-3]
ENST00000529859; ENSP00000436557; ENSG00000204965. [Q9Y5H7-1]
ENST00000614258; ENSP00000484128; ENSG00000204965. [Q9Y5H7-2]
GeneIDi56143.
KEGGihsa:56143.
UCSCiuc003lhj.2. human. [Q9Y5H7-1]

Organism-specific databases

CTDi56143.
GeneCardsiPCDHA5.
H-InvDBHIX0164437.
HGNCiHGNC:8671. PCDHA5.
HPAiHPA044557.
MIMi604966. gene.
606311. gene.
neXtProtiNX_Q9Y5H7.
PharmGKBiPA33017.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3594. Eukaryota.
ENOG410XQHI. LUCA.
GeneTreeiENSGT00840000129695.
HOGENOMiHOG000220892.
HOVERGENiHBG054878.
InParanoidiQ9Y5H7.
KOiK16493.
OMAiCRRRAEC.
OrthoDBiEOG091G00KR.
PhylomeDBiQ9Y5H7.
TreeFamiTF332299.

Miscellaneous databases

GeneWikiiPCDHA5.
GenomeRNAii56143.
PROiQ9Y5H7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000204965.
GenevisibleiQ9Y5H7. HS.

Family and domain databases

Gene3Di2.60.40.60. 6 hits.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR031904. Cadherin_CBD.
IPR020894. Cadherin_CS.
IPR013164. Cadherin_N.
[Graphical view]
PfamiPF00028. Cadherin. 5 hits.
PF08266. Cadherin_2. 1 hit.
PF15974. Cadherin_tail. 1 hit.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 6 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 6 hits.
PROSITEiPS00232. CADHERIN_1. 5 hits.
PS50268. CADHERIN_2. 6 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPCDA5_HUMAN
AccessioniPrimary (citable) accession number: Q9Y5H7
Secondary accession number(s): O75284, Q8N4R3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: November 1, 1999
Last modified: September 7, 2016
This is version 145 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.