Q9Y592 (CCD41_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 73.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Coiled-coil domain-containing protein 41 Alternative name(s): Renal carcinoma antigen NY-REN-58 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 693 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence caution | The sequence AAD42881.1 differs from that shown. Reason: Frameshift at positions 105, 590 and 601. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y592-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y592-2) The sequence of this isoform differs from the canonical sequence as follows: 1-25: Missing. 562-593: RKSLHENKLKRLQEKVEVLEAKKEELETENQV → LEQDLELGCPSVTDTYRESVFPPPPLKRDLLK 594-693: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 693 | 693 | Coiled-coil domain-containing protein 41 | PRO_0000234495 | |||||
Regions | |||||||||
| Coiled coil | 32 – 626 | 595 | Potential | ||||||
| Coiled coil | 657 – 690 | 34 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 25 | 25 | Missing in isoform 2. | VSP_037760 | |||||
| Alternative sequence | 562 – 593 | 32 | RKSLH…TENQV → LEQDLELGCPSVTDTYRESV FPPPPLKRDLLK in isoform 2. | VSP_037761 | |||||
| Alternative sequence | 594 – 693 | 100 | Missing in isoform 2. | VSP_037762 | |||||
| Natural variant | 70 | 1 | Q → R. Corresponds to variant rs2271979 [ dbSNP | Ensembl ]. | VAR_058397 | |||||
Experimental info | |||||||||
| Sequence conflict | 259 | 1 | E → G in AAD42881. Ref.1 | ||||||
| Sequence conflict | 336 | 1 | I → L in AAD42881. Ref.1 | ||||||
| Sequence conflict | 536 | 1 | E → D in AAD42881. Ref.1 | ||||||
| Sequence conflict | 537 | 1 | R → C in AAI25087. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF155115 mRNA. Translation: AAD42881.1. Frameshift. AC073655 Genomic DNA. No translation available. BC053614 mRNA. No translation available. BC125086 mRNA. Translation: AAI25087.1. BC125087 mRNA. Translation: AAI25088.1. AK056316 mRNA. No translation available. |
| IPI | IPI00180681. IPI00796371. |
| RefSeq | NP_057206.2. NM_016122.2. |
| UniGene | Hs.279209. |
3D structure databases | |
| ProteinModelPortal | Q9Y592. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-1790539. |
| STRING | 9606.ENSP00000344655. |
PTM databases | |
| PhosphoSite | Q9Y592. |
Polymorphism databases | |
| DMDM | 97045295. |
Proteomic databases | |
| PaxDb | Q9Y592. |
| PRIDE | Q9Y592. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000397807; ENSP00000380909; ENSG00000173588. ENST00000547232; ENSP00000447783; ENSG00000173588. |
| GeneID | 51134. |
| KEGG | hsa:51134. |
| UCSC | uc001tdd.3. human. |
Organism-specific databases | |
| CTD | 51134. |
| GeneCards | GC12M094702. |
| HGNC | HGNC:17966. CCDC41. |
| HPA | HPA038161. |
| neXtProt | NX_Q9Y592. |
| PharmGKB | PA142672158. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG125204. |
| HOGENOM | HOG000111412. |
| HOVERGEN | HBG053993. |
| InParanoid | Q9Y592. |
| KO | K16754. |
| OrthoDB | EOG418BMX. |
Gene expression databases | |
| ArrayExpress | Q9Y592. |
| Bgee | Q9Y592. |
| CleanEx | HS_CCDC41. |
| Genevestigator | Q9Y592. |
| GermOnline | ENSG00000173588. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| ChiTaRS | CCDC41. human. |
| GenomeRNAi | 51134. |
| NextBio | 53977. |
Entry information
| Entry name | CCD41_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y592 Secondary accession number(s): A4FVB1, Q08AP1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |

Clusters with
