Q9Y575 (ASB3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ankyrin repeat and SOCS box protein 3 Short name=ASB-3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 518 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes TNFRSF1B. Ref.6 |
| Pathway | |
| Subunit structure | Interacts with TCEB2 and TNFRSF1B. Ref.6 |
| Domain | The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes By similarity. |
| Sequence similarities | Contains 11 ANK repeats. Contains 1 SOCS box domain. |
| Sequence caution | The sequence AAI10916.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Coding sequence diversity | Alternative splicing |
| Domain | ANK repeat Repeat |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | intracellular signal transduction Inferred from electronic annotation. Source: InterPro protein ubiquitinationInferred from electronic annotation. Source: UniProtKB-UniPathway |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y575-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y575-2) The sequence of this isoform differs from the canonical sequence as follows: 1-73: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9Y575-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAMMPLVLHHPERQAELGSGLRDGGGAALRPPGRLVKQM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 518 | 518 | Ankyrin repeat and SOCS box protein 3 | PRO_0000066926 | |||||
Regions | |||||||||
| Repeat | 9 – 38 | 30 | ANK 1 | ||||||
| Repeat | 42 – 71 | 30 | ANK 2 | ||||||
| Repeat | 78 – 107 | 30 | ANK 3 | ||||||
| Repeat | 111 – 140 | 30 | ANK 4 | ||||||
| Repeat | 145 – 174 | 30 | ANK 5 | ||||||
| Repeat | 178 – 207 | 30 | ANK 6 | ||||||
| Repeat | 211 – 240 | 30 | ANK 7 | ||||||
| Repeat | 246 – 275 | 30 | ANK 8 | ||||||
| Repeat | 279 – 308 | 30 | ANK 9 | ||||||
| Repeat | 315 – 346 | 32 | ANK 10 | ||||||
| Repeat | 348 – 373 | 26 | ANK 11 | ||||||
| Domain | 441 – 504 | 64 | SOCS box | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 73 | 73 | Missing in isoform 2. | VSP_036392 | |||||
| Alternative sequence | 1 | 1 | M → MAMMPLVLHHPERQAELGSG LRDGGGAALRPPGRLVKQM in isoform 3. | VSP_044606 | |||||
Experimental info | |||||||||
| Sequence conflict | 118 | 1 | L → S in BAA91599. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of the genes encoding the ankyrin repeat and SOCS box-containing proteins Asb-1, Asb-2, Asb-3 and Asb-4." Kile B.T., Viney E.M., Willson T.A., Brodnicki T.C., Cancilla M.R., Herlihy A.S., Croker B.A., Baca M., Nicola N.A., Hilton D.J., Alexander W.S. Gene 258:31-41(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Embryo and Teratocarcinoma. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Brain, Kidney and Lung. |
| [6] | "Ankyrin repeat and SOCS box 3 (ASB3) mediates ubiquitination and degradation of tumor necrosis factor receptor II." Chung A.S., Guan Y.J., Yuan Z.L., Albina J.E., Chin Y.E. Mol. Cell. Biol. 25:4716-4726(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH TCEB2 AND TNFRSF1B. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF156778 mRNA. Translation: AAD41895.1. AK000985 mRNA. Translation: BAA91455.1. AK001283 mRNA. Translation: BAA91599.1. AK056069 mRNA. Translation: BAG51615.1. AC007883 Genomic DNA. Translation: AAY24350.1. AC008064 Genomic DNA. Translation: AAX93180.1. AC008068 Genomic DNA. No translation available. AC069157 Genomic DNA. No translation available. CH471053 Genomic DNA. Translation: EAX00167.1. CH471053 Genomic DNA. Translation: EAX00168.1. CH471053 Genomic DNA. Translation: EAX00169.1. CH471053 Genomic DNA. Translation: EAX00170.1. BC006488 mRNA. Translation: AAH06488.1. BC009569 mRNA. Translation: AAH09569.1. BC110915 mRNA. Translation: AAI10916.1. Different initiation. |
| IPI | IPI00007215. IPI00871755. IPI00921607. |
| RefSeq | NP_001157637.1. NM_001164165.1. NP_001188894.1. NM_001201965.1. NP_057199.1. NM_016115.4. NP_665862.1. NM_145863.2. |
| UniGene | Hs.40763. |
3D structure databases | |
| ProteinModelPortal | Q9Y575. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9Y575. 3 interactions. |
| STRING | 9606.ENSP00000263634. |
PTM databases | |
| PhosphoSite | Q9Y575. |
Polymorphism databases | |
| DMDM | 20532004. |
Proteomic databases | |
| PaxDb | Q9Y575. |
| PRIDE | Q9Y575. |
Protocols and materials databases | |
| DNASU | 51130. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000263634; ENSP00000263634; ENSG00000115239. ENST00000352846; ENSP00000313756; ENSG00000115239. ENST00000394717; ENSP00000378206; ENSG00000115239. ENST00000406625; ENSP00000385085; ENSG00000115239. ENST00000406687; ENSP00000384728; ENSG00000115239. |
| GeneID | 100302652. 51130. |
| KEGG | hsa:100302652. hsa:51130. |
| UCSC | uc002rxg.2. human. |
Organism-specific databases | |
| CTD | 100302652. 51130. |
| GeneCards | GC02M053750. GC02M053759. |
| HGNC | HGNC:16013. ASB3. |
| HPA | HPA003940. |
| MIM | 605760. gene. |
| neXtProt | NX_Q9Y575. |
| PharmGKB | PA25031. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0666. |
| HOVERGEN | HBG024356. |
| InParanoid | Q9Y575. |
| KO | K10325. |
| OMA | HLAYCLK. |
| OrthoDB | EOG4NVZK3. |
| PhylomeDB | Q9Y575. |
Enzyme and pathway databases | |
| Reactome | REACT_6900. Immune System. |
| UniPathway | UPA00143. |
Gene expression databases | |
| ArrayExpress | Q9Y575. |
| Bgee | Q9Y575. |
| CleanEx | HS_ASB3. |
| Genevestigator | Q9Y575. |
| GermOnline | ENSG00000115239. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.25.40.20. 3 hits. |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR001496. SOCS_C. [Graphical view] |
| Pfam | PF12796. Ank_2. 3 hits. PF07525. SOCS_box. 1 hit. [Graphical view] |
| PRINTS | PR01415. ANKYRIN. |
| SMART | SM00248. ANK. 10 hits. SM00969. SOCS_box. 1 hit. [Graphical view] |
| SUPFAM | SSF48403. ANK. 2 hits. |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 6 hits. PS50225. SOCS. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ASB3. human. |
| GenomeRNAi | 51130. |
| NextBio | 20796092. |
| SOURCE | Search... |
Entry information
| Entry name | ASB3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y575 Secondary accession number(s): B3KPA3 Q9NVZ2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
