Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin repeat and SOCS box protein 3

Gene

ASB3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes TNFRSF1B.1 Publication

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

BioCyciZFISH:ENSG00000115239-MONOMER.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat and SOCS box protein 3
Short name:
ASB-3
Gene namesi
Name:ASB3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:16013. ASB3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000115239.
ENSG00000270898.
PharmGKBiPA25031.

Polymorphism and mutation databases

BioMutaiASB3.
DMDMi20532004.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000669261 – 518Ankyrin repeat and SOCS box protein 3Add BLAST518

Proteomic databases

PaxDbiQ9Y575.
PeptideAtlasiQ9Y575.
PRIDEiQ9Y575.

PTM databases

iPTMnetiQ9Y575.
PhosphoSitePlusiQ9Y575.

Expressioni

Gene expression databases

BgeeiENSG00000115239.
CleanExiHS_ASB3.
ExpressionAtlasiQ9Y575. baseline and differential.
GenevisibleiQ9Y575. HS.

Organism-specific databases

HPAiHPA003940.

Interactioni

Subunit structurei

Interacts with TCEB2 and TNFRSF1B.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
SH2D2AQ9NP313EBI-2875625,EBI-490630

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119317. 60 interactors.
IntActiQ9Y575. 8 interactors.
MINTiMINT-8417605.
STRINGi9606.ENSP00000313756.

Structurei

3D structure databases

ProteinModelPortaliQ9Y575.
SMRiQ9Y575.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati9 – 38ANK 1Add BLAST30
Repeati42 – 71ANK 2Add BLAST30
Repeati78 – 107ANK 3Add BLAST30
Repeati111 – 140ANK 4Add BLAST30
Repeati145 – 174ANK 5Add BLAST30
Repeati178 – 207ANK 6Add BLAST30
Repeati211 – 240ANK 7Add BLAST30
Repeati246 – 275ANK 8Add BLAST30
Repeati279 – 308ANK 9Add BLAST30
Repeati315 – 346ANK 10Add BLAST32
Repeati348 – 373ANK 11Add BLAST26
Domaini441 – 504SOCS boxPROSITE-ProRule annotationAdd BLAST64

Domaini

The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes.By similarity

Sequence similaritiesi

Belongs to the ankyrin SOCS box (ASB) family.Curated
Contains 11 ANK repeats.PROSITE-ProRule annotation
Contains 1 SOCS box domain.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00530000063050.
HOGENOMiHOG000022587.
HOVERGENiHBG024356.
InParanoidiQ9Y575.
KOiK10325.
OMAiCGWNALH.
OrthoDBiEOG091G03ZR.
PhylomeDBiQ9Y575.
TreeFamiTF315127.

Family and domain databases

Gene3Di1.25.40.20. 4 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001496. SOCS_box.
[Graphical view]
PfamiPF12796. Ank_2. 2 hits.
PF13606. Ank_3. 1 hit.
PF07525. SOCS_box. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 10 hits.
SM00969. SOCS_box. 1 hit.
[Graphical view]
SUPFAMiSSF158235. SSF158235. 1 hit.
SSF48403. SSF48403. 2 hits.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 6 hits.
PS50225. SOCS. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y575-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDFTEAYADT CSTVGLAARE GNVKVLRKLL KKGRSVDVAD NRGWMPIHEA
60 70 80 90 100
AYHNSVECLQ MLINADSSEN YIKMKTFEGF CALHLAASQG HWKIVQILLE
110 120 130 140 150
AGADPNATTL EETTPLFLAV ENGQIDVLRL LLQHGANVNG SHSMCGWNSL
160 170 180 190 200
HQASFQENAE IIKLLLRKGA NKECQDDFGI TPLFVAAQYG KLESLSILIS
210 220 230 240 250
SGANVNCQAL DKATPLFIAA QEGHTKCVEL LLSSGADPDL YCNEDSWQLP
260 270 280 290 300
IHAAAQMGHT KILDLLIPLT NRACDTGLNK VSPVYSAVFG GHEDCLEILL
310 320 330 340 350
RNGYSPDAQA CLVFGFSSPV CMAFQKDCEF FGIVNILLKY GAQINELHLA
360 370 380 390 400
YCLKYEKFSI FRYFLRKGCS LGPWNHIYEF VNHAIKAQAK YKEWLPHLLV
410 420 430 440 450
AGFDPLILLC NSWIDSVSID TLIFTLEFTN WKTLAPAVER MLSARASNAW
460 470 480 490 500
ILQQHIATVP SLTHLCRLEI RSSLKSERLR SDSYISQLPL PRSLHNYLLY
510
EDVLRMYEVP ELAAIQDG
Length:518
Mass (Da):57,745
Last modified:November 1, 1999 - v1
Checksum:iE6FC2EF76DD814DF
GO
Isoform 2 (identifier: Q9Y575-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: Missing.

Note: No experimental confirmation available.
Show »
Length:445
Mass (Da):49,617
Checksum:iDF2A006FEA3DD409
GO
Isoform 3 (identifier: Q9Y575-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAMMPLVLHHPERQAELGSGLRDGGGAALRPPGRLVKQM

Note: No experimental confirmation available.
Show »
Length:556
Mass (Da):61,775
Checksum:iA73962ECA9F739CD
GO

Sequence cautioni

The sequence AAI10916 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti118L → S in BAA91599 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0363921 – 73Missing in isoform 2. 1 PublicationAdd BLAST73
Alternative sequenceiVSP_0446061M → MAMMPLVLHHPERQAELGSG LRDGGGAALRPPGRLVKQM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF156778 mRNA. Translation: AAD41895.1.
AK000985 mRNA. Translation: BAA91455.1.
AK001283 mRNA. Translation: BAA91599.1.
AK056069 mRNA. Translation: BAG51615.1.
AC007883 Genomic DNA. Translation: AAY24350.1.
AC008064 Genomic DNA. Translation: AAX93180.1.
AC008068 Genomic DNA. No translation available.
AC069157 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAX00167.1.
CH471053 Genomic DNA. Translation: EAX00168.1.
CH471053 Genomic DNA. Translation: EAX00169.1.
CH471053 Genomic DNA. Translation: EAX00170.1.
BC006488 mRNA. Translation: AAH06488.1.
BC009569 mRNA. Translation: AAH09569.1.
BC110915 mRNA. Translation: AAI10916.1. Different initiation.
CCDSiCCDS1846.1. [Q9Y575-1]
CCDS1847.1. [Q9Y575-2]
RefSeqiNP_001157637.1. NM_001164165.1. [Q9Y575-3]
NP_001188894.1. NM_001201965.1. [Q9Y575-2]
NP_057199.1. NM_016115.4. [Q9Y575-1]
NP_665862.1. NM_145863.2. [Q9Y575-2]
UniGeneiHs.40763.

Genome annotation databases

EnsembliENST00000263634; ENSP00000263634; ENSG00000115239. [Q9Y575-1]
ENST00000394717; ENSP00000378206; ENSG00000115239. [Q9Y575-2]
ENST00000406687; ENSP00000384728; ENSG00000115239. [Q9Y575-2]
GeneIDi100302652.
51130.
KEGGihsa:100302652.
hsa:51130.
UCSCiuc002rxg.3. human. [Q9Y575-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF156778 mRNA. Translation: AAD41895.1.
AK000985 mRNA. Translation: BAA91455.1.
AK001283 mRNA. Translation: BAA91599.1.
AK056069 mRNA. Translation: BAG51615.1.
AC007883 Genomic DNA. Translation: AAY24350.1.
AC008064 Genomic DNA. Translation: AAX93180.1.
AC008068 Genomic DNA. No translation available.
AC069157 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAX00167.1.
CH471053 Genomic DNA. Translation: EAX00168.1.
CH471053 Genomic DNA. Translation: EAX00169.1.
CH471053 Genomic DNA. Translation: EAX00170.1.
BC006488 mRNA. Translation: AAH06488.1.
BC009569 mRNA. Translation: AAH09569.1.
BC110915 mRNA. Translation: AAI10916.1. Different initiation.
CCDSiCCDS1846.1. [Q9Y575-1]
CCDS1847.1. [Q9Y575-2]
RefSeqiNP_001157637.1. NM_001164165.1. [Q9Y575-3]
NP_001188894.1. NM_001201965.1. [Q9Y575-2]
NP_057199.1. NM_016115.4. [Q9Y575-1]
NP_665862.1. NM_145863.2. [Q9Y575-2]
UniGeneiHs.40763.

3D structure databases

ProteinModelPortaliQ9Y575.
SMRiQ9Y575.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119317. 60 interactors.
IntActiQ9Y575. 8 interactors.
MINTiMINT-8417605.
STRINGi9606.ENSP00000313756.

PTM databases

iPTMnetiQ9Y575.
PhosphoSitePlusiQ9Y575.

Polymorphism and mutation databases

BioMutaiASB3.
DMDMi20532004.

Proteomic databases

PaxDbiQ9Y575.
PeptideAtlasiQ9Y575.
PRIDEiQ9Y575.

Protocols and materials databases

DNASUi51130.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263634; ENSP00000263634; ENSG00000115239. [Q9Y575-1]
ENST00000394717; ENSP00000378206; ENSG00000115239. [Q9Y575-2]
ENST00000406687; ENSP00000384728; ENSG00000115239. [Q9Y575-2]
GeneIDi100302652.
51130.
KEGGihsa:100302652.
hsa:51130.
UCSCiuc002rxg.3. human. [Q9Y575-1]

Organism-specific databases

CTDi100302652.
51130.
GeneCardsiASB3.
GPR75-ASB3.
HGNCiHGNC:16013. ASB3.
HPAiHPA003940.
MIMi605760. gene.
neXtProtiNX_Q9Y575.
OpenTargetsiENSG00000115239.
ENSG00000270898.
PharmGKBiPA25031.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00530000063050.
HOGENOMiHOG000022587.
HOVERGENiHBG024356.
InParanoidiQ9Y575.
KOiK10325.
OMAiCGWNALH.
OrthoDBiEOG091G03ZR.
PhylomeDBiQ9Y575.
TreeFamiTF315127.

Enzyme and pathway databases

UniPathwayiUPA00143.
BioCyciZFISH:ENSG00000115239-MONOMER.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.

Miscellaneous databases

ChiTaRSiASB3. human.
GeneWikiiASB3.
PROiQ9Y575.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000115239.
CleanExiHS_ASB3.
ExpressionAtlasiQ9Y575. baseline and differential.
GenevisibleiQ9Y575. HS.

Family and domain databases

Gene3Di1.25.40.20. 4 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001496. SOCS_box.
[Graphical view]
PfamiPF12796. Ank_2. 2 hits.
PF13606. Ank_3. 1 hit.
PF07525. SOCS_box. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 10 hits.
SM00969. SOCS_box. 1 hit.
[Graphical view]
SUPFAMiSSF158235. SSF158235. 1 hit.
SSF48403. SSF48403. 2 hits.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 6 hits.
PS50225. SOCS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiASB3_HUMAN
AccessioniPrimary (citable) accession number: Q9Y575
Secondary accession number(s): B3KPA3
, D6W5B4, D6W5B5, G8JLA9, Q2TAI4, Q53TN0, Q53TN8, Q9NVZ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: November 1, 1999
Last modified: November 30, 2016
This is version 142 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.