Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Actin-binding protein IPP

Gene

IPP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

May play a role in organizing the actin cytoskeleton.

GO - Molecular functioni

  • actin binding Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Actin-binding protein IPP
Alternative name(s):
Intracisternal A particle-promoted polypeptide
Short name:
IPP
Kelch-like protein 27
Gene namesi
Name:IPP
Synonyms:KLHL27
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:6108. IPP.

Subcellular locationi

GO - Cellular componenti

  • actin cytoskeleton Source: ProtInc
  • Cul3-RING ubiquitin ligase complex Source: GO_Central
  • cytoplasm Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA29908.

Polymorphism and mutation databases

BioMutaiIPP.
DMDMi13431578.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 584584Actin-binding protein IPPPRO_0000119075Add
BLAST

Proteomic databases

MaxQBiQ9Y573.
PaxDbiQ9Y573.
PeptideAtlasiQ9Y573.
PRIDEiQ9Y573.

PTM databases

iPTMnetiQ9Y573.
PhosphoSiteiQ9Y573.

Expressioni

Gene expression databases

BgeeiENSG00000197429.
CleanExiHS_IPP.
GenevisibleiQ9Y573. HS.

Interactioni

GO - Molecular functioni

  • actin binding Source: ProtInc

Protein-protein interaction databases

BioGridi109861. 13 interactions.
IntActiQ9Y573. 6 interactions.
STRINGi9606.ENSP00000379739.

Structurei

3D structure databases

ProteinModelPortaliQ9Y573.
SMRiQ9Y573. Positions 14-241, 288-583.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini37 – 10468BTBPROSITE-ProRule annotationAdd
BLAST
Repeati289 – 34355Kelch 1Add
BLAST
Repeati344 – 39047Kelch 2Add
BLAST
Repeati391 – 43747Kelch 3Add
BLAST
Repeati439 – 48547Kelch 4Add
BLAST
Repeati487 – 53347Kelch 5Add
BLAST
Repeati535 – 58349Kelch 6Add
BLAST

Sequence similaritiesi

Contains 1 BTB (POZ) domain.PROSITE-ProRule annotation
Contains 6 Kelch repeats.Curated

Keywords - Domaini

Kelch repeat, Repeat

Phylogenomic databases

eggNOGiKOG4441. Eukaryota.
ENOG410XNX8. LUCA.
GeneTreeiENSGT00760000119153.
HOGENOMiHOG000230814.
HOVERGENiHBG014286.
InParanoidiQ9Y573.
KOiK13956.
OMAiMLEFTEN.
OrthoDBiEOG091G03Y2.
PhylomeDBiQ9Y573.
TreeFamiTF329218.

Family and domain databases

Gene3Di2.120.10.80. 2 hits.
InterProiIPR011705. BACK.
IPR017096. BTB-kelch_protein.
IPR000210. BTB/POZ_dom.
IPR011043. Gal_Oxase/kelch_b-propeller.
IPR030104. IPP.
IPR015915. Kelch-typ_b-propeller.
IPR006652. Kelch_1.
IPR011333. SKP1/BTB/POZ.
[Graphical view]
PANTHERiPTHR24412:SF35. PTHR24412:SF35. 1 hit.
PfamiPF07707. BACK. 1 hit.
PF00651. BTB. 1 hit.
PF01344. Kelch_1. 6 hits.
[Graphical view]
PIRSFiPIRSF037037. Kelch-like_protein_gigaxonin. 1 hit.
SMARTiSM00875. BACK. 1 hit.
SM00225. BTB. 1 hit.
SM00612. Kelch. 6 hits.
[Graphical view]
SUPFAMiSSF50965. SSF50965. 1 hit.
SSF54695. SSF54695. 1 hit.
PROSITEiPS50097. BTB. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y573-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MANEDCPKAA DSPFSSDKHA QLILAQINKM RNGQHFCDVQ LQVGQESFKA
60 70 80 90 100
HRLVLAASSP YFAALFTGGM KESSKDVVPI LGIEAGIFQI LLDFIYTGIV
110 120 130 140 150
NIGVNNVQEL IIAADMLQLT EVVHLCCEFL KGQIDPLNCI GIFQFSEQIA
160 170 180 190 200
CHDLLEFSEN YIHVHFLEVH SGEEFLALTK DQLIKILRSE ELSIEDEYQV
210 220 230 240 250
FLAAMQWILK DLGKRRKHVV EVLDPIRFPL LPPQRLLKYI EGVSDFNLRV
260 270 280 290 300
ALQTLLKEYC EVCKSPKENK FCSFLQTSKV RPRKKARKYL YAVGGYTRLQ
310 320 330 340 350
GGRWSDSRAL SCVERFDTFS QYWTTVSSLH QARSGLGVTV LGGMVYAIGG
360 370 380 390 400
EKDSMIFDCT ECYDPVTKQW TTVASMNHPR CGLGVCVCYG AIYALGGWVG
410 420 430 440 450
AEIGNTIERF DPDENKWEVV GNMAVSRYYF GCCEMQGLIY VIGGISNEGI
460 470 480 490 500
ELRSFEVYDP LSKRWSPLPP MGTRRAYLGV AALNDCIYSV GGWNETQDAL
510 520 530 540 550
HTVEKYSFEE EKWVEVASMK VPRAGMCVVA VNGLLYVSGG RSSSHDFLAP
560 570 580
GTLDSVEVYN PHSDTWTEIG NMITSRCEGG VAVL
Length:584
Mass (Da):65,261
Last modified:November 1, 1999 - v1
Checksum:iC63EF25D74924AB8
GO
Isoform 2 (identifier: Q9Y573-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     551-584: GTLDSVEVYNPHSDTWTEIGNMITSRCEGGVAVL → DTHRYEVFRLKWENMCILFNDHKTLTKGIFNL

Show »
Length:582
Mass (Da):65,592
Checksum:i25C6E2EF4E26438B
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti264 – 2641K → R.2 Publications
Corresponds to variant rs28375469 [ dbSNP | Ensembl ].
VAR_050045

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei551 – 58434GTLDS…GVAVL → DTHRYEVFRLKWENMCILFN DHKTLTKGIFNL in isoform 2. 1 PublicationVSP_040993Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF156857 mRNA. Translation: AAD39007.1.
AK023880 mRNA. Translation: BAG51233.1.
AL604028, BX664740, CR589949 Genomic DNA. Translation: CAM12886.1.
BX664740, AL604028, CR589949 Genomic DNA. Translation: CAM12889.1.
CH471059 Genomic DNA. Translation: EAX06950.1.
CH471059 Genomic DNA. Translation: EAX06951.1.
BC032544 mRNA. Translation: AAH32544.1.
CCDSiCCDS30702.1. [Q9Y573-1]
CCDS44132.1. [Q9Y573-2]
RefSeqiNP_001138821.1. NM_001145349.1. [Q9Y573-2]
NP_005888.1. NM_005897.2. [Q9Y573-1]
UniGeneiHs.744252.

Genome annotation databases

EnsembliENST00000359942; ENSP00000353024; ENSG00000197429. [Q9Y573-2]
ENST00000396478; ENSP00000379739; ENSG00000197429. [Q9Y573-1]
GeneIDi3652.
KEGGihsa:3652.
UCSCiuc001cos.5. human. [Q9Y573-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF156857 mRNA. Translation: AAD39007.1.
AK023880 mRNA. Translation: BAG51233.1.
AL604028, BX664740, CR589949 Genomic DNA. Translation: CAM12886.1.
BX664740, AL604028, CR589949 Genomic DNA. Translation: CAM12889.1.
CH471059 Genomic DNA. Translation: EAX06950.1.
CH471059 Genomic DNA. Translation: EAX06951.1.
BC032544 mRNA. Translation: AAH32544.1.
CCDSiCCDS30702.1. [Q9Y573-1]
CCDS44132.1. [Q9Y573-2]
RefSeqiNP_001138821.1. NM_001145349.1. [Q9Y573-2]
NP_005888.1. NM_005897.2. [Q9Y573-1]
UniGeneiHs.744252.

3D structure databases

ProteinModelPortaliQ9Y573.
SMRiQ9Y573. Positions 14-241, 288-583.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109861. 13 interactions.
IntActiQ9Y573. 6 interactions.
STRINGi9606.ENSP00000379739.

PTM databases

iPTMnetiQ9Y573.
PhosphoSiteiQ9Y573.

Polymorphism and mutation databases

BioMutaiIPP.
DMDMi13431578.

Proteomic databases

MaxQBiQ9Y573.
PaxDbiQ9Y573.
PeptideAtlasiQ9Y573.
PRIDEiQ9Y573.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000359942; ENSP00000353024; ENSG00000197429. [Q9Y573-2]
ENST00000396478; ENSP00000379739; ENSG00000197429. [Q9Y573-1]
GeneIDi3652.
KEGGihsa:3652.
UCSCiuc001cos.5. human. [Q9Y573-1]

Organism-specific databases

CTDi3652.
GeneCardsiIPP.
HGNCiHGNC:6108. IPP.
MIMi147485. gene.
neXtProtiNX_Q9Y573.
PharmGKBiPA29908.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4441. Eukaryota.
ENOG410XNX8. LUCA.
GeneTreeiENSGT00760000119153.
HOGENOMiHOG000230814.
HOVERGENiHBG014286.
InParanoidiQ9Y573.
KOiK13956.
OMAiMLEFTEN.
OrthoDBiEOG091G03Y2.
PhylomeDBiQ9Y573.
TreeFamiTF329218.

Miscellaneous databases

ChiTaRSiIPP. human.
GenomeRNAii3652.
PROiQ9Y573.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000197429.
CleanExiHS_IPP.
GenevisibleiQ9Y573. HS.

Family and domain databases

Gene3Di2.120.10.80. 2 hits.
InterProiIPR011705. BACK.
IPR017096. BTB-kelch_protein.
IPR000210. BTB/POZ_dom.
IPR011043. Gal_Oxase/kelch_b-propeller.
IPR030104. IPP.
IPR015915. Kelch-typ_b-propeller.
IPR006652. Kelch_1.
IPR011333. SKP1/BTB/POZ.
[Graphical view]
PANTHERiPTHR24412:SF35. PTHR24412:SF35. 1 hit.
PfamiPF07707. BACK. 1 hit.
PF00651. BTB. 1 hit.
PF01344. Kelch_1. 6 hits.
[Graphical view]
PIRSFiPIRSF037037. Kelch-like_protein_gigaxonin. 1 hit.
SMARTiSM00875. BACK. 1 hit.
SM00225. BTB. 1 hit.
SM00612. Kelch. 6 hits.
[Graphical view]
SUPFAMiSSF50965. SSF50965. 1 hit.
SSF54695. SSF54695. 1 hit.
PROSITEiPS50097. BTB. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiIPP_HUMAN
AccessioniPrimary (citable) accession number: Q9Y573
Secondary accession number(s): A2A6V4, D3DQ11, Q8N5C3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: November 1, 1999
Last modified: September 7, 2016
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.