Q9Y573 (IPP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Actin-binding protein IPP Alternative name(s): Intracisternal A particle-promoted polypeptide Short name=IPP Kelch-like protein 27 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 584 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May play a role in organizing the actin cytoskeleton. |
| Subcellular location | |
| Sequence similarities | Contains 1 BTB (POZ) domain. Contains 6 Kelch repeats. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Kelch repeat Repeat |
| Ligand | Actin-binding |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | actin cytoskeleton Traceable author statement. Source: ProtInc cytoplasmInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | actin binding Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y573-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y573-2) The sequence of this isoform differs from the canonical sequence as follows: 551-584: GTLDSVEVYNPHSDTWTEIGNMITSRCEGGVAVL → DTHRYEVFRLKWENMCILFNDHKTLTKGIFNL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 584 | 584 | Actin-binding protein IPP | PRO_0000119075 | |||||
Regions | |||||||||
| Domain | 37 – 104 | 68 | BTB | ||||||
| Repeat | 289 – 343 | 55 | Kelch 1 | ||||||
| Repeat | 344 – 390 | 47 | Kelch 2 | ||||||
| Repeat | 391 – 437 | 47 | Kelch 3 | ||||||
| Repeat | 439 – 485 | 47 | Kelch 4 | ||||||
| Repeat | 487 – 533 | 47 | Kelch 5 | ||||||
| Repeat | 535 – 583 | 49 | Kelch 6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 551 – 584 | 34 | GTLDS…GVAVL → DTHRYEVFRLKWENMCILFN DHKTLTKGIFNL in isoform 2. | VSP_040993 | |||||
| Natural variant | 264 | 1 | K → R. Ref.4 Ref.5 Corresponds to variant rs28375469 [ dbSNP | Ensembl ]. | VAR_050045 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of IPP, a novel human gene encoding an actin-binding, kelch-like protein." Kim I.F., Mohammadi E., Huang R.C. Gene 228:73-83(1999) [PubMed: 10072760] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Thyroid. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-264. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ARG-264. Tissue: Uterus. |
| [6] | "The IPP gene is assigned to human chromosome 1p32-1p22." Chang-Yeh A., Jabs E.W., Li X., Dracopoli N.C., Huang R.C. Genomics 15:239-241(1993) [PubMed: 8432546] [Abstract] Cited for: CHROMOSOMAL LOCATION. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF156857 mRNA. Translation: AAD39007.1. AK023880 mRNA. Translation: BAG51233.1. AL604028, BX664740, CR589949 Genomic DNA. Translation: CAM12886.1. BX664740, AL604028, CR589949 Genomic DNA. Translation: CAM12889.1. CH471059 Genomic DNA. Translation: EAX06950.1. CH471059 Genomic DNA. Translation: EAX06951.1. BC032544 mRNA. Translation: AAH32544.1. |
| IPI | IPI00001117. IPI00642759. |
| RefSeq | NP_001138821.1. NM_001145349.1. NP_005888.1. NM_005897.2. |
| UniGene | Hs.699548. |
3D structure databases | |
| ProteinModelPortal | Q9Y573. |
| SMR | Q9Y573. Positions 15-246, 287-584. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9Y573. |
Polymorphism databases | |
| DMDM | 13431578. |
Proteomic databases | |
| PRIDE | Q9Y573. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000359942; ENSP00000353024; ENSG00000197429. ENST00000396474; ENSP00000379736; ENSG00000197429. ENST00000396478; ENSP00000379739; ENSG00000197429. |
| GeneID | 3652. |
| KEGG | hsa:3652. |
| UCSC | uc001cot.1. human. |
Organism-specific databases | |
| CTD | 3652. |
| GeneCards | GC01M046159. |
| H-InvDB | HIX0199830. |
| HGNC | HGNC:6108. IPP. |
| MIM | 147485. gene. |
| neXtProt | NX_Q9Y573. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00570000078759. |
| HOGENOM | HBG713858. |
| HOVERGEN | HBG014286. |
| InParanoid | Q9Y573. |
| OMA | NLCCEFL. |
| PhylomeDB | Q9Y573. |
Gene expression databases | |
| ArrayExpress | Q9Y573. |
| Bgee | Q9Y573. |
| CleanEx | HS_IPP. |
| Genevestigator | Q9Y573. |
| GermOnline | ENSG00000197429. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011705. BACK. IPR000210. BTB/POZ-like. IPR011333. BTB/POZ_fold. IPR013069. BTB_POZ. IPR015916. Gal_Oxidase_b-propeller. IPR017096. Kelch-like_gigaxonin. IPR006652. Kelch_1. [Graphical view] |
| Gene3D | G3DSA:3.30.710.10. BTB/POZ_fold. 1 hit. G3DSA:2.130.10.80. Gal_Oxidase_b-propeller. 2 hits. |
| KO | K13956. |
| Pfam | PF07707. BACK. 1 hit. PF00651. BTB. 1 hit. PF01344. Kelch_1. 6 hits. [Graphical view] |
| PIRSF | PIRSF037037. Kelch-like_protein_gigaxonin. 1 hit. |
| SMART | SM00875. BACK. 1 hit. SM00225. BTB. 1 hit. SM00612. Kelch. 6 hits. [Graphical view] |
| SUPFAM | SSF54695. BTB/POZ_fold. 1 hit. |
| PROSITE | PS50097. BTB. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 14283. |
| SOURCE | Search... |
Entry information
| Entry name | IPP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y573 Secondary accession number(s): A2A6V4, D3DQ11, Q8N5C3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with