Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Actin-binding protein IPP

Gene

IPP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

May play a role in organizing the actin cytoskeleton.

GO - Molecular functioni

  • actin binding Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionActin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Actin-binding protein IPP
Alternative name(s):
Intracisternal A particle-promoted polypeptide
Short name:
IPP
Kelch-like protein 27
Gene namesi
Name:IPP
Synonyms:KLHL27
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000197429.10
HGNCiHGNC:6108 IPP
MIMi147485 gene
neXtProtiNX_Q9Y573

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi3652
OpenTargetsiENSG00000197429
PharmGKBiPA29908

Polymorphism and mutation databases

BioMutaiIPP
DMDMi13431578

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001190751 – 584Actin-binding protein IPPAdd BLAST584

Proteomic databases

PaxDbiQ9Y573
PeptideAtlasiQ9Y573
PRIDEiQ9Y573

PTM databases

iPTMnetiQ9Y573
PhosphoSitePlusiQ9Y573

Expressioni

Gene expression databases

BgeeiENSG00000197429
CleanExiHS_IPP
GenevisibleiQ9Y573 HS

Interactioni

GO - Molecular functioni

  • actin binding Source: ProtInc

Protein-protein interaction databases

BioGridi109861, 18 interactors
IntActiQ9Y573, 7 interactors
STRINGi9606.ENSP00000379739

Structurei

3D structure databases

ProteinModelPortaliQ9Y573
SMRiQ9Y573
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini37 – 104BTBPROSITE-ProRule annotationAdd BLAST68
Repeati289 – 343Kelch 1Add BLAST55
Repeati344 – 390Kelch 2Add BLAST47
Repeati391 – 437Kelch 3Add BLAST47
Repeati439 – 485Kelch 4Add BLAST47
Repeati487 – 533Kelch 5Add BLAST47
Repeati535 – 583Kelch 6Add BLAST49

Keywords - Domaini

Kelch repeat, Repeat

Phylogenomic databases

eggNOGiKOG4441 Eukaryota
ENOG410XNX8 LUCA
GeneTreeiENSGT00760000118825
HOGENOMiHOG000230814
HOVERGENiHBG014286
InParanoidiQ9Y573
KOiK13956
OMAiEVVNLCC
OrthoDBiEOG091G03Y2
PhylomeDBiQ9Y573
TreeFamiTF329218

Family and domain databases

Gene3Di2.120.10.80, 1 hit
InterProiView protein in InterPro
IPR011705 BACK
IPR017096 BTB-kelch_protein
IPR000210 BTB/POZ_dom
IPR011043 Gal_Oxase/kelch_b-propeller
IPR015915 Kelch-typ_b-propeller
IPR006652 Kelch_1
IPR011333 SKP1/BTB/POZ_sf
PfamiView protein in Pfam
PF07707 BACK, 1 hit
PF00651 BTB, 1 hit
PF01344 Kelch_1, 6 hits
PIRSFiPIRSF037037 Kelch-like_protein_gigaxonin, 1 hit
SMARTiView protein in SMART
SM00875 BACK, 1 hit
SM00225 BTB, 1 hit
SM00612 Kelch, 6 hits
SUPFAMiSSF50965 SSF50965, 1 hit
SSF54695 SSF54695, 1 hit
PROSITEiView protein in PROSITE
PS50097 BTB, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y573-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MANEDCPKAA DSPFSSDKHA QLILAQINKM RNGQHFCDVQ LQVGQESFKA
60 70 80 90 100
HRLVLAASSP YFAALFTGGM KESSKDVVPI LGIEAGIFQI LLDFIYTGIV
110 120 130 140 150
NIGVNNVQEL IIAADMLQLT EVVHLCCEFL KGQIDPLNCI GIFQFSEQIA
160 170 180 190 200
CHDLLEFSEN YIHVHFLEVH SGEEFLALTK DQLIKILRSE ELSIEDEYQV
210 220 230 240 250
FLAAMQWILK DLGKRRKHVV EVLDPIRFPL LPPQRLLKYI EGVSDFNLRV
260 270 280 290 300
ALQTLLKEYC EVCKSPKENK FCSFLQTSKV RPRKKARKYL YAVGGYTRLQ
310 320 330 340 350
GGRWSDSRAL SCVERFDTFS QYWTTVSSLH QARSGLGVTV LGGMVYAIGG
360 370 380 390 400
EKDSMIFDCT ECYDPVTKQW TTVASMNHPR CGLGVCVCYG AIYALGGWVG
410 420 430 440 450
AEIGNTIERF DPDENKWEVV GNMAVSRYYF GCCEMQGLIY VIGGISNEGI
460 470 480 490 500
ELRSFEVYDP LSKRWSPLPP MGTRRAYLGV AALNDCIYSV GGWNETQDAL
510 520 530 540 550
HTVEKYSFEE EKWVEVASMK VPRAGMCVVA VNGLLYVSGG RSSSHDFLAP
560 570 580
GTLDSVEVYN PHSDTWTEIG NMITSRCEGG VAVL
Length:584
Mass (Da):65,261
Last modified:November 1, 1999 - v1
Checksum:iC63EF25D74924AB8
GO
Isoform 2 (identifier: Q9Y573-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     551-584: GTLDSVEVYNPHSDTWTEIGNMITSRCEGGVAVL → DTHRYEVFRLKWENMCILFNDHKTLTKGIFNL

Show »
Length:582
Mass (Da):65,592
Checksum:i25C6E2EF4E26438B
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_050045264K → R2 PublicationsCorresponds to variant dbSNP:rs28375469Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_040993551 – 584GTLDS…GVAVL → DTHRYEVFRLKWENMCILFN DHKTLTKGIFNL in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF156857 mRNA Translation: AAD39007.1
AK023880 mRNA Translation: BAG51233.1
AL604028 Genomic DNA No translation available.
BX664740 Genomic DNA No translation available.
CR589949 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06950.1
CH471059 Genomic DNA Translation: EAX06951.1
BC032544 mRNA Translation: AAH32544.1
CCDSiCCDS30702.1 [Q9Y573-1]
CCDS44132.1 [Q9Y573-2]
RefSeqiNP_001138821.1, NM_001145349.1 [Q9Y573-2]
NP_005888.1, NM_005897.2 [Q9Y573-1]
UniGeneiHs.744252

Genome annotation databases

EnsembliENST00000359942; ENSP00000353024; ENSG00000197429 [Q9Y573-2]
ENST00000396478; ENSP00000379739; ENSG00000197429 [Q9Y573-1]
GeneIDi3652
KEGGihsa:3652
UCSCiuc001cos.5 human [Q9Y573-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiIPP_HUMAN
AccessioniPrimary (citable) accession number: Q9Y573
Secondary accession number(s): A2A6V4, D3DQ11, Q8N5C3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: November 1, 1999
Last modified: May 23, 2018
This is version 148 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health