Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UDP-glucuronosyltransferase 2A1

Gene

UGT2A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. Active on odorants and seems to be involved in olfaction; it could help clear lipophilic odorant molecules from the sensory epithelium.1 Publication

Catalytic activityi

UDP-glucuronate + acceptor = UDP + acceptor beta-D-glucuronoside.

Kineticsi

  1. KM=75.4 µM for 3-hydroxybiphenyl1 Publication
  2. KM=59.5 µM for umbelliferone1 Publication
  3. KM=51.6 µM for S---b-citronellol1 Publication
  4. KM=170.1 µM for borneol1 Publication
  5. KM=56.2 µM for testosterone1 Publication
  6. KM=251 µM for UDP-glucuronate1 Publication
  1. Vmax=2.60 nmol/min/mg enzyme with 3-hydroxybiphenyl as substrate1 Publication
  2. Vmax=0.61 nmol/min/mg enzyme with umbelliferone as substrate1 Publication
  3. Vmax=1.98 nmol/min/mg enzyme with S---b-citronellol as substrate1 Publication
  4. Vmax=1.05 nmol/min/mg enzyme with borneol as substrate1 Publication
  5. Vmax=0.25 nmol/min/mg enzyme with testosterone as substrate1 Publication

GO - Molecular functioni

  • glucuronosyltransferase activity Source: UniProtKB

GO - Biological processi

  • cellular glucuronidation Source: BHF-UCL
  • cellular response to hormone stimulus Source: GO_Central
  • detection of chemical stimulus Source: ProtInc
  • flavonoid biosynthetic process Source: GO_Central
  • flavonoid glucuronidation Source: GO_Central
  • metabolic process Source: GOC
  • sensory perception of smell Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Keywords - Biological processi

Olfaction, Sensory transduction

Enzyme and pathway databases

ReactomeiREACT_6784. Glucuronidation.

Protein family/group databases

CAZyiGT1. Glycosyltransferase Family 1.

Names & Taxonomyi

Protein namesi
Recommended name:
UDP-glucuronosyltransferase 2A1 (EC:2.4.1.17)
Short name:
UDPGT 2A1
Gene namesi
Name:UGT2A1
Synonyms:UGT2A2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:12542. UGT2A1.
HGNC:28183. UGT2A2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini21 – 490470ExtracellularSequence AnalysisAdd
BLAST
Transmembranei491 – 50717HelicalSequence AnalysisAdd
BLAST
Topological domaini508 – 52720CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37184.

Polymorphism and mutation databases

BioMutaiUGT2A1.
DMDMi296452854.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020Sequence AnalysisAdd
BLAST
Chaini21 – 527507UDP-glucuronosyltransferase 2A1PRO_0000036023Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi49 – 491N-linked (GlcNAc...)Sequence Analysis
Glycosylationi313 – 3131N-linked (GlcNAc...)Sequence Analysis
Glycosylationi347 – 3471N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ9Y4X1.
PaxDbiQ9Y4X1.
PRIDEiQ9Y4X1.

PTM databases

PhosphoSiteiQ9Y4X1.

Expressioni

Tissue specificityi

Olfactory epithelium and brain. Isoform 2 is mainly expressed in the nasal mucosa.2 Publications

Gene expression databases

BgeeiQ9Y4X1.
CleanExiHS_UGT2A1.
ExpressionAtlasiQ9Y4X1. baseline.
GenevisibleiQ9Y4X1. HS.

Organism-specific databases

HPAiHPA017261.
HPA045108.

Interactioni

Protein-protein interaction databases

BioGridi300002. 1 interaction.
STRINGi9606.ENSP00000387888.

Structurei

3D structure databases

ProteinModelPortaliQ9Y4X1.
SMRiQ9Y4X1. Positions 222-445.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the UDP-glycosyltransferase family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1819.
GeneTreeiENSGT00760000118949.
HOGENOMiHOG000220831.
HOVERGENiHBG004033.
InParanoidiQ9Y4X1.
KOiK00699.
OMAiPMSARDE.
OrthoDBiEOG7GBFWS.
PhylomeDBiQ9Y4X1.
TreeFamiTF315472.

Family and domain databases

InterProiIPR002213. UDP_glucos_trans.
[Graphical view]
PANTHERiPTHR11926. PTHR11926. 1 hit.
PfamiPF00201. UDPGT. 1 hit.
[Graphical view]
PROSITEiPS00375. UDPGT. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y4X1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLNNLLLFSL QISLIGTTLG GNVLIWPMEG SHWLNVKIII DELIKKEHNV
60 70 80 90 100
TVLVASGALF ITPTSNPSLT FEIYRVPFGK ERIEGVIKDF VLTWLENRPS
110 120 130 140 150
PSTIWRFYQE MAKVIKDFHM VSQEICDGVL KNQQLMAKLK KSKFEVLVSD
160 170 180 190 200
PVFPCGDIVA LKLGIPFMYS LRFSPASTVE KHCGKVPYPP SYVPAVLSEL
210 220 230 240 250
TDQMSFTDRI RNFISYHLQD YMFETLWKSW DSYYSKALGR PTTLCETMGK
260 270 280 290 300
AEIWLIRTYW DFEFPRPYLP NFEFVGGLHC KPAKPLPKEM EEFIQSSGKN
310 320 330 340 350
GVVVFSLGSM VKNLTEEKAN LIASALAQIP QKVLWRYKGK KPATLGNNTQ
360 370 380 390 400
LFDWIPQNDL LGHPKTKAFI THGGTNGIYE AIYHGVPMVG VPMFADQPDN
410 420 430 440 450
IAHMKAKGAA VEVNLNTMTS VDLLSALRTV INEPSYKENA MRLSRIHHDQ
460 470 480 490 500
PVKPLDRAVF WIEFVMRHKG AKHLRVAAHD LTWFQYHSLD VIGFLLVCVT
510 520
TAIFLVIQCC LFSCQKFGKI GKKKKRE
Length:527
Mass (Da):59,926
Last modified:May 18, 2010 - v2
Checksum:iC55858D7185273A8
GO
Isoform 2 (identifier: Q9Y4X1-2) [UniParc]FASTAAdd to basket

Also known as: UGT2A2

The sequence of this isoform differs from the canonical sequence as follows:
     1-237: MLNNLLLFSL...KSWDSYYSKA → MVSIRDFTMP...GEWNSYYSKI

Show »
Length:536
Mass (Da):60,772
Checksum:i2234435E46224749
GO
Isoform 3 (identifier: Q9Y4X1-3) [UniParc]FASTAAdd to basket

Also known as: UGT2A2 variant 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-237: MLNNLLLFSL...KSWDSYYSKA → MVSIRDFTMP...GEWNSYYSKI
     288-331: Missing.

Show »
Length:492
Mass (Da):56,053
Checksum:i4A3E94D5433A9289
GO
Isoform 4 (identifier: Q9Y4X1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-237: A → ALDGSHWLNI...GEWNSYYSKI
     288-331: Missing.

Note: No experimental confirmation available.
Show »
Length:693
Mass (Da):79,091
Checksum:i7310B7229C9E2AA1
GO
Isoform 5 (identifier: Q9Y4X1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     238-238: L → LGGLLLCCPGWSAVADLGSLQPLLPGFKRFSRLSLHCSWDYRLPA
     288-331: Missing.

Note: No experimental confirmation available.
Show »
Length:527
Mass (Da):59,991
Checksum:iB5E0848AD4D14497
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti92 – 921L → S in CAB41974 (PubMed:10359671).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti75 – 751R → K.2 Publications
Corresponds to variant rs1347046 [ dbSNP | Ensembl ].
VAR_063113
Natural varianti308 – 3081G → R.
Corresponds to variant rs4148301 [ dbSNP | Ensembl ].
VAR_024686
Natural varianti391 – 3911V → I.1 Publication
Corresponds to variant rs4148304 [ dbSNP | Ensembl ].
VAR_057326

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 237237MLNNL…YYSKA → MVSIRDFTMPKKFVQMLVFN LTLTEVVLSGNVLIWPTDGS HWLNIKIILEELIQRNHNVT VLASSATLFINSNPDSPVNF EVIPVSYKKSNIDSLIEHMI MLWIDHRPTPLTIWAFYKEL GKLLDTFFQINIQLCDGVLK NPKLMARLQKGGFDVLVADP VTICGDLVALKLGIPFMYTL RFSPASTVERHCGKIPAPVS YVPAALSELTDQMTFGERIK NTISYSLQDYIFQSYWGEWN SYYSKI in isoform 2 and isoform 3. 1 PublicationVSP_039375Add
BLAST
Alternative sequencei237 – 2371A → ALDGSHWLNIKIILEELIQR NHNVTVLASSATLFINSNPD SPVNFEVIPVSYKKSNIDSL IEHMIMLWIDHRPTPLTIWA FYKELGKLLDTFFQINIQLC DGVLKNPKLMARLQKGGFDV LVADPVTICGDLVALKLGIP FMYTLRFSPASTVERHCGKI PAPVSYVPAALSELTDQMTF GERIKNTISYSLQDYIFQSY WGEWNSYYSKI in isoform 4. 1 PublicationVSP_044733
Alternative sequencei238 – 2381L → LGGLLLCCPGWSAVADLGSL QPLLPGFKRFSRLSLHCSWD YRLPA in isoform 5. 1 PublicationVSP_045577
Alternative sequencei288 – 33144Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsVSP_039376Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ006054 mRNA. Translation: CAB41974.1.
FJ664272 mRNA. Translation: ACV70034.1.
FJ664273 mRNA. Translation: ACV70035.1.
AK304249 mRNA. Translation: BAG65116.1.
AK314209 mRNA. No translation available.
AC093829 Genomic DNA. No translation available.
CCDSiCCDS3529.1. [Q9Y4X1-1]
CCDS58901.1. [Q9Y4X1-5]
CCDS58902.1. [Q9Y4X1-4]
RefSeqiNP_001099147.2. NM_001105677.2. [Q9Y4X1-2]
NP_001239203.2. NM_001252274.2.
NP_001239204.2. NM_001252275.2.
NP_001288162.1. NM_001301233.1. [Q9Y4X1-3]
NP_001288168.1. NM_001301239.1.
NP_006789.3. NM_006798.4.
UniGeneiHs.225950.

Genome annotation databases

EnsembliENST00000286604; ENSP00000286604; ENSG00000173610.
ENST00000457664; ENSP00000387888; ENSG00000173610.
ENST00000503640; ENSP00000424478; ENSG00000173610.
ENST00000514019; ENSP00000425497; ENSG00000270386.
ENST00000604021; ENSP00000474383; ENSG00000271271. [Q9Y4X1-3]
ENST00000604629; ENSP00000475028; ENSG00000271271. [Q9Y4X1-2]
GeneIDi10941.
574537.
KEGGihsa:10941.
hsa:574537.
UCSCiuc003hem.4. human. [Q9Y4X1-1]
uc010ihs.3. human. [Q9Y4X1-2]
uc021xox.1. human. [Q9Y4X1-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ006054 mRNA. Translation: CAB41974.1.
FJ664272 mRNA. Translation: ACV70034.1.
FJ664273 mRNA. Translation: ACV70035.1.
AK304249 mRNA. Translation: BAG65116.1.
AK314209 mRNA. No translation available.
AC093829 Genomic DNA. No translation available.
CCDSiCCDS3529.1. [Q9Y4X1-1]
CCDS58901.1. [Q9Y4X1-5]
CCDS58902.1. [Q9Y4X1-4]
RefSeqiNP_001099147.2. NM_001105677.2. [Q9Y4X1-2]
NP_001239203.2. NM_001252274.2.
NP_001239204.2. NM_001252275.2.
NP_001288162.1. NM_001301233.1. [Q9Y4X1-3]
NP_001288168.1. NM_001301239.1.
NP_006789.3. NM_006798.4.
UniGeneiHs.225950.

3D structure databases

ProteinModelPortaliQ9Y4X1.
SMRiQ9Y4X1. Positions 222-445.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi300002. 1 interaction.
STRINGi9606.ENSP00000387888.

Chemistry

ChEMBLiCHEMBL1743321.

Protein family/group databases

CAZyiGT1. Glycosyltransferase Family 1.

PTM databases

PhosphoSiteiQ9Y4X1.

Polymorphism and mutation databases

BioMutaiUGT2A1.
DMDMi296452854.

Proteomic databases

MaxQBiQ9Y4X1.
PaxDbiQ9Y4X1.
PRIDEiQ9Y4X1.

Protocols and materials databases

DNASUi10941.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000286604; ENSP00000286604; ENSG00000173610.
ENST00000457664; ENSP00000387888; ENSG00000173610.
ENST00000503640; ENSP00000424478; ENSG00000173610.
ENST00000514019; ENSP00000425497; ENSG00000270386.
ENST00000604021; ENSP00000474383; ENSG00000271271. [Q9Y4X1-3]
ENST00000604629; ENSP00000475028; ENSG00000271271. [Q9Y4X1-2]
GeneIDi10941.
574537.
KEGGihsa:10941.
hsa:574537.
UCSCiuc003hem.4. human. [Q9Y4X1-1]
uc010ihs.3. human. [Q9Y4X1-2]
uc021xox.1. human. [Q9Y4X1-3]

Organism-specific databases

CTDi10941.
574537.
GeneCardsiGC04M070454.
GC04M070455.
H-InvDBHIX0031395.
HGNCiHGNC:12542. UGT2A1.
HGNC:28183. UGT2A2.
HPAiHPA017261.
HPA045108.
MIMi604716. gene.
neXtProtiNX_Q9Y4X1.
PharmGKBiPA37184.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG1819.
GeneTreeiENSGT00760000118949.
HOGENOMiHOG000220831.
HOVERGENiHBG004033.
InParanoidiQ9Y4X1.
KOiK00699.
OMAiPMSARDE.
OrthoDBiEOG7GBFWS.
PhylomeDBiQ9Y4X1.
TreeFamiTF315472.

Enzyme and pathway databases

ReactomeiREACT_6784. Glucuronidation.

Miscellaneous databases

GeneWikiiUGT2A1.
UGT2A2.
NextBioi35534862.
PROiQ9Y4X1.
SOURCEiSearch...

Gene expression databases

BgeeiQ9Y4X1.
CleanExiHS_UGT2A1.
ExpressionAtlasiQ9Y4X1. baseline.
GenevisibleiQ9Y4X1. HS.

Family and domain databases

InterProiIPR002213. UDP_glucos_trans.
[Graphical view]
PANTHERiPTHR11926. PTHR11926. 1 hit.
PfamiPF00201. UDPGT. 1 hit.
[Graphical view]
PROSITEiPS00375. UDPGT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a novel human olfactory UDP-glucuronosyltransferase."
    Jedlitschky G.A., Cassidy A.J., Sales M., Pratt N., Burchell B.
    Biochem. J. 340:837-843(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), BIOPHYSICOCHEMICAL PROPERTIES, TISSUE SPECIFICITY, VARIANT LYS-75.
    Tissue: Olfactory bulb.
  2. "Human UDP-glucuronosyltransferase UGT2A2: cDNA construction, expression, and functional characterization in comparison with UGT2A1 and UGT2A3."
    Sneitz N., Court M.H., Zhang X., Laajanen K., Yee K.K., Dalton P., Ding X., Finel M.
    Pharmacogenet. Genomics 19:923-934(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, TISSUE SPECIFICITY.
    Tissue: Nasal mucosa.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5), VARIANTS LYS-75 AND ILE-391.
    Tissue: Trachea.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiUD2A1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y4X1
Secondary accession number(s): B4E2F4
, D3GER1, D3GER2, E9PDM7, J3KNA3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2003
Last sequence update: May 18, 2010
Last modified: June 24, 2015
This is version 127 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

According to HGNC, UGT2A1 and UGT2A2 are 2 separate genes. However, they share common exons at the C-terminus, suggesting that UGT2A1 and UGT2A2 are different isoforms encoded by the same locus.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.