Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y4X1

- UD2A1_HUMAN

UniProt

Q9Y4X1 - UD2A1_HUMAN

Protein

UDP-glucuronosyltransferase 2A1

Gene

UGT2A1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 119 (01 Oct 2014)
      Sequence version 2 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. Active on odorants and seems to be involved in olfaction; it could help clear lipophilic odorant molecules from the sensory epithelium.1 Publication

    Catalytic activityi

    UDP-glucuronate + acceptor = UDP + acceptor beta-D-glucuronoside.

    Kineticsi

    1. KM=75.4 µM for 3-hydroxybiphenyl1 Publication
    2. KM=59.5 µM for umbelliferone1 Publication
    3. KM=51.6 µM for S---b-citronellol1 Publication
    4. KM=170.1 µM for borneol1 Publication
    5. KM=56.2 µM for testosterone1 Publication
    6. KM=251 µM for UDP-glucuronate1 Publication

    Vmax=2.60 nmol/min/mg enzyme with 3-hydroxybiphenyl as substrate1 Publication

    Vmax=0.61 nmol/min/mg enzyme with umbelliferone as substrate1 Publication

    Vmax=1.98 nmol/min/mg enzyme with S---b-citronellol as substrate1 Publication

    Vmax=1.05 nmol/min/mg enzyme with borneol as substrate1 Publication

    Vmax=0.25 nmol/min/mg enzyme with testosterone as substrate1 Publication

    GO - Molecular functioni

    1. glucuronosyltransferase activity Source: UniProtKB

    GO - Biological processi

    1. cellular glucuronidation Source: BHF-UCL
    2. detection of chemical stimulus Source: ProtInc
    3. metabolic process Source: GOC
    4. sensory perception of smell Source: UniProtKB-KW

    Keywords - Molecular functioni

    Glycosyltransferase, Transferase

    Keywords - Biological processi

    Olfaction, Sensory transduction

    Enzyme and pathway databases

    ReactomeiREACT_6784. Glucuronidation.

    Protein family/group databases

    CAZyiGT1. Glycosyltransferase Family 1.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    UDP-glucuronosyltransferase 2A1 (EC:2.4.1.17)
    Short name:
    UDPGT 2A1
    Gene namesi
    Name:UGT2A1
    Synonyms:UGT2A2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:12542. UGT2A1.
    HGNC:28183. UGT2A2.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA37184.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2020Sequence AnalysisAdd
    BLAST
    Chaini21 – 527507UDP-glucuronosyltransferase 2A1PRO_0000036023Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi49 – 491N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi313 – 3131N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi347 – 3471N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ9Y4X1.
    PaxDbiQ9Y4X1.
    PRIDEiQ9Y4X1.

    PTM databases

    PhosphoSiteiQ9Y4X1.

    Expressioni

    Tissue specificityi

    Olfactory epithelium and brain. Isoform 2 is mainly expressed in the nasal mucosa.2 Publications

    Gene expression databases

    BgeeiQ9Y4X1.
    CleanExiHS_UGT2A1.
    GenevestigatoriQ9Y4X1.

    Organism-specific databases

    HPAiHPA017261.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000286604.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Y4X1.
    SMRiQ9Y4X1. Positions 222-445.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini21 – 490470ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini508 – 52720CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei491 – 50717HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the UDP-glycosyltransferase family.Curated

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1819.
    HOGENOMiHOG000220831.
    HOVERGENiHBG004033.
    InParanoidiQ9Y4X1.
    KOiK00699.
    OMAiGSHWINI.
    OrthoDBiEOG7GBFWS.
    PhylomeDBiQ9Y4X1.
    TreeFamiTF315472.

    Family and domain databases

    InterProiIPR002213. UDP_glucos_trans.
    [Graphical view]
    PANTHERiPTHR11926. PTHR11926. 1 hit.
    PfamiPF00201. UDPGT. 1 hit.
    [Graphical view]
    PROSITEiPS00375. UDPGT. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9Y4X1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLNNLLLFSL QISLIGTTLG GNVLIWPMEG SHWLNVKIII DELIKKEHNV    50
    TVLVASGALF ITPTSNPSLT FEIYRVPFGK ERIEGVIKDF VLTWLENRPS 100
    PSTIWRFYQE MAKVIKDFHM VSQEICDGVL KNQQLMAKLK KSKFEVLVSD 150
    PVFPCGDIVA LKLGIPFMYS LRFSPASTVE KHCGKVPYPP SYVPAVLSEL 200
    TDQMSFTDRI RNFISYHLQD YMFETLWKSW DSYYSKALGR PTTLCETMGK 250
    AEIWLIRTYW DFEFPRPYLP NFEFVGGLHC KPAKPLPKEM EEFIQSSGKN 300
    GVVVFSLGSM VKNLTEEKAN LIASALAQIP QKVLWRYKGK KPATLGNNTQ 350
    LFDWIPQNDL LGHPKTKAFI THGGTNGIYE AIYHGVPMVG VPMFADQPDN 400
    IAHMKAKGAA VEVNLNTMTS VDLLSALRTV INEPSYKENA MRLSRIHHDQ 450
    PVKPLDRAVF WIEFVMRHKG AKHLRVAAHD LTWFQYHSLD VIGFLLVCVT 500
    TAIFLVIQCC LFSCQKFGKI GKKKKRE 527
    Length:527
    Mass (Da):59,926
    Last modified:May 18, 2010 - v2
    Checksum:iC55858D7185273A8
    GO
    Isoform 2 (identifier: Q9Y4X1-2) [UniParc]FASTAAdd to Basket

    Also known as: UGT2A2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-237: MLNNLLLFSL...KSWDSYYSKA → MVSIRDFTMP...GEWNSYYSKI

    Show »
    Length:536
    Mass (Da):60,772
    Checksum:i2234435E46224749
    GO
    Isoform 3 (identifier: Q9Y4X1-3) [UniParc]FASTAAdd to Basket

    Also known as: UGT2A2 variant 1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-237: MLNNLLLFSL...KSWDSYYSKA → MVSIRDFTMP...GEWNSYYSKI
         288-331: Missing.

    Show »
    Length:492
    Mass (Da):56,053
    Checksum:i4A3E94D5433A9289
    GO
    Isoform 4 (identifier: Q9Y4X1-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         237-237: A → ALDGSHWLNI...GEWNSYYSKI
         288-331: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:693
    Mass (Da):79,091
    Checksum:i7310B7229C9E2AA1
    GO
    Isoform 5 (identifier: Q9Y4X1-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         238-238: L → LGGLLLCCPGWSAVADLGSLQPLLPGFKRFSRLSLHCSWDYRLPA
         288-331: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:527
    Mass (Da):59,991
    Checksum:iB5E0848AD4D14497
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti92 – 921L → S in CAB41974. (PubMed:10359671)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti75 – 751R → K.2 Publications
    Corresponds to variant rs1347046 [ dbSNP | Ensembl ].
    VAR_063113
    Natural varianti308 – 3081G → R.
    Corresponds to variant rs4148301 [ dbSNP | Ensembl ].
    VAR_024686
    Natural varianti391 – 3911V → I.1 Publication
    Corresponds to variant rs4148304 [ dbSNP | Ensembl ].
    VAR_057326

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 237237MLNNL…YYSKA → MVSIRDFTMPKKFVQMLVFN LTLTEVVLSGNVLIWPTDGS HWLNIKIILEELIQRNHNVT VLASSATLFINSNPDSPVNF EVIPVSYKKSNIDSLIEHMI MLWIDHRPTPLTIWAFYKEL GKLLDTFFQINIQLCDGVLK NPKLMARLQKGGFDVLVADP VTICGDLVALKLGIPFMYTL RFSPASTVERHCGKIPAPVS YVPAALSELTDQMTFGERIK NTISYSLQDYIFQSYWGEWN SYYSKI in isoform 2 and isoform 3. 1 PublicationVSP_039375Add
    BLAST
    Alternative sequencei237 – 2371A → ALDGSHWLNIKIILEELIQR NHNVTVLASSATLFINSNPD SPVNFEVIPVSYKKSNIDSL IEHMIMLWIDHRPTPLTIWA FYKELGKLLDTFFQINIQLC DGVLKNPKLMARLQKGGFDV LVADPVTICGDLVALKLGIP FMYTLRFSPASTVERHCGKI PAPVSYVPAALSELTDQMTF GERIKNTISYSLQDYIFQSY WGEWNSYYSKI in isoform 4. 1 PublicationVSP_044733
    Alternative sequencei238 – 2381L → LGGLLLCCPGWSAVADLGSL QPLLPGFKRFSRLSLHCSWD YRLPA in isoform 5. 1 PublicationVSP_045577
    Alternative sequencei288 – 33144Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsVSP_039376Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ006054 mRNA. Translation: CAB41974.1.
    FJ664272 mRNA. Translation: ACV70034.1.
    FJ664273 mRNA. Translation: ACV70035.1.
    AK304249 mRNA. Translation: BAG65116.1.
    AK314209 mRNA. No translation available.
    AC093829 Genomic DNA. No translation available.
    CCDSiCCDS3529.1. [Q9Y4X1-1]
    CCDS58901.1. [Q9Y4X1-5]
    CCDS58902.1. [Q9Y4X1-4]
    RefSeqiNP_001099147.2. NM_001105677.2. [Q9Y4X1-2]
    NP_001239203.1. NM_001252274.1. [Q9Y4X1-4]
    NP_001239204.1. NM_001252275.1. [Q9Y4X1-5]
    NP_006789.2. NM_006798.3. [Q9Y4X1-1]
    UniGeneiHs.225950.

    Genome annotation databases

    EnsembliENST00000286604; ENSP00000286604; ENSG00000173610. [Q9Y4X1-5]
    ENST00000457664; ENSP00000387888; ENSG00000173610. [Q9Y4X1-2]
    ENST00000503640; ENSP00000424478; ENSG00000173610. [Q9Y4X1-1]
    ENST00000514019; ENSP00000425497; ENSG00000270386. [Q9Y4X1-4]
    GeneIDi10941.
    574537.
    KEGGihsa:10941.
    hsa:574537.
    UCSCiuc003hem.4. human. [Q9Y4X1-1]
    uc010ihs.3. human. [Q9Y4X1-2]
    uc021xox.1. human. [Q9Y4X1-3]

    Polymorphism databases

    DMDMi296452854.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ006054 mRNA. Translation: CAB41974.1 .
    FJ664272 mRNA. Translation: ACV70034.1 .
    FJ664273 mRNA. Translation: ACV70035.1 .
    AK304249 mRNA. Translation: BAG65116.1 .
    AK314209 mRNA. No translation available.
    AC093829 Genomic DNA. No translation available.
    CCDSi CCDS3529.1. [Q9Y4X1-1 ]
    CCDS58901.1. [Q9Y4X1-5 ]
    CCDS58902.1. [Q9Y4X1-4 ]
    RefSeqi NP_001099147.2. NM_001105677.2. [Q9Y4X1-2 ]
    NP_001239203.1. NM_001252274.1. [Q9Y4X1-4 ]
    NP_001239204.1. NM_001252275.1. [Q9Y4X1-5 ]
    NP_006789.2. NM_006798.3. [Q9Y4X1-1 ]
    UniGenei Hs.225950.

    3D structure databases

    ProteinModelPortali Q9Y4X1.
    SMRi Q9Y4X1. Positions 222-445.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000286604.

    Chemistry

    ChEMBLi CHEMBL1743321.

    Protein family/group databases

    CAZyi GT1. Glycosyltransferase Family 1.

    PTM databases

    PhosphoSitei Q9Y4X1.

    Polymorphism databases

    DMDMi 296452854.

    Proteomic databases

    MaxQBi Q9Y4X1.
    PaxDbi Q9Y4X1.
    PRIDEi Q9Y4X1.

    Protocols and materials databases

    DNASUi 10941.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000286604 ; ENSP00000286604 ; ENSG00000173610 . [Q9Y4X1-5 ]
    ENST00000457664 ; ENSP00000387888 ; ENSG00000173610 . [Q9Y4X1-2 ]
    ENST00000503640 ; ENSP00000424478 ; ENSG00000173610 . [Q9Y4X1-1 ]
    ENST00000514019 ; ENSP00000425497 ; ENSG00000270386 . [Q9Y4X1-4 ]
    GeneIDi 10941.
    574537.
    KEGGi hsa:10941.
    hsa:574537.
    UCSCi uc003hem.4. human. [Q9Y4X1-1 ]
    uc010ihs.3. human. [Q9Y4X1-2 ]
    uc021xox.1. human. [Q9Y4X1-3 ]

    Organism-specific databases

    CTDi 10941.
    574537.
    GeneCardsi GC04M070454.
    GC04M070489.
    H-InvDB HIX0031395.
    HGNCi HGNC:12542. UGT2A1.
    HGNC:28183. UGT2A2.
    HPAi HPA017261.
    MIMi 604716. gene.
    neXtProti NX_Q9Y4X1.
    PharmGKBi PA37184.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1819.
    HOGENOMi HOG000220831.
    HOVERGENi HBG004033.
    InParanoidi Q9Y4X1.
    KOi K00699.
    OMAi GSHWINI.
    OrthoDBi EOG7GBFWS.
    PhylomeDBi Q9Y4X1.
    TreeFami TF315472.

    Enzyme and pathway databases

    Reactomei REACT_6784. Glucuronidation.

    Miscellaneous databases

    GeneWikii UGT2A1.
    UGT2A2.
    NextBioi 35534862.
    PROi Q9Y4X1.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9Y4X1.
    CleanExi HS_UGT2A1.
    Genevestigatori Q9Y4X1.

    Family and domain databases

    InterProi IPR002213. UDP_glucos_trans.
    [Graphical view ]
    PANTHERi PTHR11926. PTHR11926. 1 hit.
    Pfami PF00201. UDPGT. 1 hit.
    [Graphical view ]
    PROSITEi PS00375. UDPGT. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of a novel human olfactory UDP-glucuronosyltransferase."
      Jedlitschky G.A., Cassidy A.J., Sales M., Pratt N., Burchell B.
      Biochem. J. 340:837-843(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), BIOPHYSICOCHEMICAL PROPERTIES, TISSUE SPECIFICITY, VARIANT LYS-75.
      Tissue: Olfactory bulb.
    2. "Human UDP-glucuronosyltransferase UGT2A2: cDNA construction, expression, and functional characterization in comparison with UGT2A1 and UGT2A3."
      Sneitz N., Court M.H., Zhang X., Laajanen K., Yee K.K., Dalton P., Ding X., Finel M.
      Pharmacogenet. Genomics 19:923-934(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, TISSUE SPECIFICITY.
      Tissue: Nasal mucosa.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5), VARIANTS LYS-75 AND ILE-391.
      Tissue: Trachea.
    4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

    Entry informationi

    Entry nameiUD2A1_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y4X1
    Secondary accession number(s): B4E2F4
    , D3GER1, D3GER2, E9PDM7, J3KNA3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 26, 2003
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 119 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3