Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Y4X1

- UD2A1_HUMAN

UniProt

Q9Y4X1 - UD2A1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

UDP-glucuronosyltransferase 2A1

Gene

UGT2A1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. Active on odorants and seems to be involved in olfaction; it could help clear lipophilic odorant molecules from the sensory epithelium.1 Publication

Catalytic activityi

UDP-glucuronate + acceptor = UDP + acceptor beta-D-glucuronoside.

Kineticsi

  1. KM=75.4 µM for 3-hydroxybiphenyl1 Publication
  2. KM=59.5 µM for umbelliferone1 Publication
  3. KM=51.6 µM for S---b-citronellol1 Publication
  4. KM=170.1 µM for borneol1 Publication
  5. KM=56.2 µM for testosterone1 Publication
  6. KM=251 µM for UDP-glucuronate1 Publication

Vmax=2.60 nmol/min/mg enzyme with 3-hydroxybiphenyl as substrate1 Publication

Vmax=0.61 nmol/min/mg enzyme with umbelliferone as substrate1 Publication

Vmax=1.98 nmol/min/mg enzyme with S---b-citronellol as substrate1 Publication

Vmax=1.05 nmol/min/mg enzyme with borneol as substrate1 Publication

Vmax=0.25 nmol/min/mg enzyme with testosterone as substrate1 Publication

GO - Molecular functioni

  1. glucuronosyltransferase activity Source: UniProtKB

GO - Biological processi

  1. cellular glucuronidation Source: BHF-UCL
  2. detection of chemical stimulus Source: ProtInc
  3. metabolic process Source: GOC
  4. sensory perception of smell Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Keywords - Biological processi

Olfaction, Sensory transduction

Enzyme and pathway databases

ReactomeiREACT_6784. Glucuronidation.

Protein family/group databases

CAZyiGT1. Glycosyltransferase Family 1.

Names & Taxonomyi

Protein namesi
Recommended name:
UDP-glucuronosyltransferase 2A1 (EC:2.4.1.17)
Short name:
UDPGT 2A1
Gene namesi
Name:UGT2A1
Synonyms:UGT2A2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:12542. UGT2A1.
HGNC:28183. UGT2A2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini21 – 490470ExtracellularSequence AnalysisAdd
BLAST
Transmembranei491 – 50717HelicalSequence AnalysisAdd
BLAST
Topological domaini508 – 52720CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37184.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020Sequence AnalysisAdd
BLAST
Chaini21 – 527507UDP-glucuronosyltransferase 2A1PRO_0000036023Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi49 – 491N-linked (GlcNAc...)Sequence Analysis
Glycosylationi313 – 3131N-linked (GlcNAc...)Sequence Analysis
Glycosylationi347 – 3471N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ9Y4X1.
PaxDbiQ9Y4X1.
PRIDEiQ9Y4X1.

PTM databases

PhosphoSiteiQ9Y4X1.

Expressioni

Tissue specificityi

Olfactory epithelium and brain. Isoform 2 is mainly expressed in the nasal mucosa.2 Publications

Gene expression databases

BgeeiQ9Y4X1.
CleanExiHS_UGT2A1.
GenevestigatoriQ9Y4X1.

Organism-specific databases

HPAiHPA017261.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000286604.

Structurei

3D structure databases

ProteinModelPortaliQ9Y4X1.
SMRiQ9Y4X1. Positions 222-445.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the UDP-glycosyltransferase family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1819.
GeneTreeiENSGT00760000118949.
HOGENOMiHOG000220831.
HOVERGENiHBG004033.
InParanoidiQ9Y4X1.
KOiK00699.
OMAiGSHWINI.
OrthoDBiEOG7GBFWS.
PhylomeDBiQ9Y4X1.
TreeFamiTF315472.

Family and domain databases

InterProiIPR002213. UDP_glucos_trans.
[Graphical view]
PANTHERiPTHR11926. PTHR11926. 1 hit.
PfamiPF00201. UDPGT. 1 hit.
[Graphical view]
PROSITEiPS00375. UDPGT. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9Y4X1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLNNLLLFSL QISLIGTTLG GNVLIWPMEG SHWLNVKIII DELIKKEHNV
60 70 80 90 100
TVLVASGALF ITPTSNPSLT FEIYRVPFGK ERIEGVIKDF VLTWLENRPS
110 120 130 140 150
PSTIWRFYQE MAKVIKDFHM VSQEICDGVL KNQQLMAKLK KSKFEVLVSD
160 170 180 190 200
PVFPCGDIVA LKLGIPFMYS LRFSPASTVE KHCGKVPYPP SYVPAVLSEL
210 220 230 240 250
TDQMSFTDRI RNFISYHLQD YMFETLWKSW DSYYSKALGR PTTLCETMGK
260 270 280 290 300
AEIWLIRTYW DFEFPRPYLP NFEFVGGLHC KPAKPLPKEM EEFIQSSGKN
310 320 330 340 350
GVVVFSLGSM VKNLTEEKAN LIASALAQIP QKVLWRYKGK KPATLGNNTQ
360 370 380 390 400
LFDWIPQNDL LGHPKTKAFI THGGTNGIYE AIYHGVPMVG VPMFADQPDN
410 420 430 440 450
IAHMKAKGAA VEVNLNTMTS VDLLSALRTV INEPSYKENA MRLSRIHHDQ
460 470 480 490 500
PVKPLDRAVF WIEFVMRHKG AKHLRVAAHD LTWFQYHSLD VIGFLLVCVT
510 520
TAIFLVIQCC LFSCQKFGKI GKKKKRE
Length:527
Mass (Da):59,926
Last modified:May 18, 2010 - v2
Checksum:iC55858D7185273A8
GO
Isoform 2 (identifier: Q9Y4X1-2) [UniParc]FASTAAdd to Basket

Also known as: UGT2A2

The sequence of this isoform differs from the canonical sequence as follows:
     1-237: MLNNLLLFSL...KSWDSYYSKA → MVSIRDFTMP...GEWNSYYSKI

Show »
Length:536
Mass (Da):60,772
Checksum:i2234435E46224749
GO
Isoform 3 (identifier: Q9Y4X1-3) [UniParc]FASTAAdd to Basket

Also known as: UGT2A2 variant 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-237: MLNNLLLFSL...KSWDSYYSKA → MVSIRDFTMP...GEWNSYYSKI
     288-331: Missing.

Show »
Length:492
Mass (Da):56,053
Checksum:i4A3E94D5433A9289
GO
Isoform 4 (identifier: Q9Y4X1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-237: A → ALDGSHWLNI...GEWNSYYSKI
     288-331: Missing.

Note: No experimental confirmation available.

Show »
Length:693
Mass (Da):79,091
Checksum:i7310B7229C9E2AA1
GO
Isoform 5 (identifier: Q9Y4X1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     238-238: L → LGGLLLCCPGWSAVADLGSLQPLLPGFKRFSRLSLHCSWDYRLPA
     288-331: Missing.

Note: No experimental confirmation available.

Show »
Length:527
Mass (Da):59,991
Checksum:iB5E0848AD4D14497
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti92 – 921L → S in CAB41974. (PubMed:10359671)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti75 – 751R → K.2 Publications
Corresponds to variant rs1347046 [ dbSNP | Ensembl ].
VAR_063113
Natural varianti308 – 3081G → R.
Corresponds to variant rs4148301 [ dbSNP | Ensembl ].
VAR_024686
Natural varianti391 – 3911V → I.1 Publication
Corresponds to variant rs4148304 [ dbSNP | Ensembl ].
VAR_057326

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 237237MLNNL…YYSKA → MVSIRDFTMPKKFVQMLVFN LTLTEVVLSGNVLIWPTDGS HWLNIKIILEELIQRNHNVT VLASSATLFINSNPDSPVNF EVIPVSYKKSNIDSLIEHMI MLWIDHRPTPLTIWAFYKEL GKLLDTFFQINIQLCDGVLK NPKLMARLQKGGFDVLVADP VTICGDLVALKLGIPFMYTL RFSPASTVERHCGKIPAPVS YVPAALSELTDQMTFGERIK NTISYSLQDYIFQSYWGEWN SYYSKI in isoform 2 and isoform 3. 1 PublicationVSP_039375Add
BLAST
Alternative sequencei237 – 2371A → ALDGSHWLNIKIILEELIQR NHNVTVLASSATLFINSNPD SPVNFEVIPVSYKKSNIDSL IEHMIMLWIDHRPTPLTIWA FYKELGKLLDTFFQINIQLC DGVLKNPKLMARLQKGGFDV LVADPVTICGDLVALKLGIP FMYTLRFSPASTVERHCGKI PAPVSYVPAALSELTDQMTF GERIKNTISYSLQDYIFQSY WGEWNSYYSKI in isoform 4. 1 PublicationVSP_044733
Alternative sequencei238 – 2381L → LGGLLLCCPGWSAVADLGSL QPLLPGFKRFSRLSLHCSWD YRLPA in isoform 5. 1 PublicationVSP_045577
Alternative sequencei288 – 33144Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsVSP_039376Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ006054 mRNA. Translation: CAB41974.1.
FJ664272 mRNA. Translation: ACV70034.1.
FJ664273 mRNA. Translation: ACV70035.1.
AK304249 mRNA. Translation: BAG65116.1.
AK314209 mRNA. No translation available.
AC093829 Genomic DNA. No translation available.
CCDSiCCDS3529.1. [Q9Y4X1-1]
CCDS58901.1. [Q9Y4X1-5]
CCDS58902.1. [Q9Y4X1-4]
RefSeqiNP_001099147.2. NM_001105677.2. [Q9Y4X1-2]
NP_001239203.2. NM_001252274.2.
NP_001239204.2. NM_001252275.2.
NP_001288162.1. NM_001301233.1. [Q9Y4X1-3]
NP_001288168.1. NM_001301239.1.
NP_006789.3. NM_006798.4.
UniGeneiHs.225950.

Genome annotation databases

EnsembliENST00000286604; ENSP00000286604; ENSG00000173610.
ENST00000457664; ENSP00000387888; ENSG00000173610.
ENST00000503640; ENSP00000424478; ENSG00000173610.
ENST00000514019; ENSP00000425497; ENSG00000270386.
ENST00000604021; ENSP00000474383; ENSG00000271271. [Q9Y4X1-3]
ENST00000604629; ENSP00000475028; ENSG00000271271. [Q9Y4X1-2]
GeneIDi10941.
574537.
KEGGihsa:10941.
hsa:574537.
UCSCiuc003hem.4. human. [Q9Y4X1-1]
uc010ihs.3. human. [Q9Y4X1-2]
uc021xox.1. human. [Q9Y4X1-3]

Polymorphism databases

DMDMi296452854.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ006054 mRNA. Translation: CAB41974.1 .
FJ664272 mRNA. Translation: ACV70034.1 .
FJ664273 mRNA. Translation: ACV70035.1 .
AK304249 mRNA. Translation: BAG65116.1 .
AK314209 mRNA. No translation available.
AC093829 Genomic DNA. No translation available.
CCDSi CCDS3529.1. [Q9Y4X1-1 ]
CCDS58901.1. [Q9Y4X1-5 ]
CCDS58902.1. [Q9Y4X1-4 ]
RefSeqi NP_001099147.2. NM_001105677.2. [Q9Y4X1-2 ]
NP_001239203.2. NM_001252274.2.
NP_001239204.2. NM_001252275.2.
NP_001288162.1. NM_001301233.1. [Q9Y4X1-3 ]
NP_001288168.1. NM_001301239.1.
NP_006789.3. NM_006798.4.
UniGenei Hs.225950.

3D structure databases

ProteinModelPortali Q9Y4X1.
SMRi Q9Y4X1. Positions 222-445.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000286604.

Chemistry

ChEMBLi CHEMBL1743321.

Protein family/group databases

CAZyi GT1. Glycosyltransferase Family 1.

PTM databases

PhosphoSitei Q9Y4X1.

Polymorphism databases

DMDMi 296452854.

Proteomic databases

MaxQBi Q9Y4X1.
PaxDbi Q9Y4X1.
PRIDEi Q9Y4X1.

Protocols and materials databases

DNASUi 10941.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000286604 ; ENSP00000286604 ; ENSG00000173610 .
ENST00000457664 ; ENSP00000387888 ; ENSG00000173610 .
ENST00000503640 ; ENSP00000424478 ; ENSG00000173610 .
ENST00000514019 ; ENSP00000425497 ; ENSG00000270386 .
ENST00000604021 ; ENSP00000474383 ; ENSG00000271271 . [Q9Y4X1-3 ]
ENST00000604629 ; ENSP00000475028 ; ENSG00000271271 . [Q9Y4X1-2 ]
GeneIDi 10941.
574537.
KEGGi hsa:10941.
hsa:574537.
UCSCi uc003hem.4. human. [Q9Y4X1-1 ]
uc010ihs.3. human. [Q9Y4X1-2 ]
uc021xox.1. human. [Q9Y4X1-3 ]

Organism-specific databases

CTDi 10941.
574537.
GeneCardsi GC04M070454.
GC04M070455.
H-InvDB HIX0031395.
HGNCi HGNC:12542. UGT2A1.
HGNC:28183. UGT2A2.
HPAi HPA017261.
MIMi 604716. gene.
neXtProti NX_Q9Y4X1.
PharmGKBi PA37184.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1819.
GeneTreei ENSGT00760000118949.
HOGENOMi HOG000220831.
HOVERGENi HBG004033.
InParanoidi Q9Y4X1.
KOi K00699.
OMAi GSHWINI.
OrthoDBi EOG7GBFWS.
PhylomeDBi Q9Y4X1.
TreeFami TF315472.

Enzyme and pathway databases

Reactomei REACT_6784. Glucuronidation.

Miscellaneous databases

GeneWikii UGT2A1.
UGT2A2.
NextBioi 35534862.
PROi Q9Y4X1.
SOURCEi Search...

Gene expression databases

Bgeei Q9Y4X1.
CleanExi HS_UGT2A1.
Genevestigatori Q9Y4X1.

Family and domain databases

InterProi IPR002213. UDP_glucos_trans.
[Graphical view ]
PANTHERi PTHR11926. PTHR11926. 1 hit.
Pfami PF00201. UDPGT. 1 hit.
[Graphical view ]
PROSITEi PS00375. UDPGT. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a novel human olfactory UDP-glucuronosyltransferase."
    Jedlitschky G.A., Cassidy A.J., Sales M., Pratt N., Burchell B.
    Biochem. J. 340:837-843(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), BIOPHYSICOCHEMICAL PROPERTIES, TISSUE SPECIFICITY, VARIANT LYS-75.
    Tissue: Olfactory bulb.
  2. "Human UDP-glucuronosyltransferase UGT2A2: cDNA construction, expression, and functional characterization in comparison with UGT2A1 and UGT2A3."
    Sneitz N., Court M.H., Zhang X., Laajanen K., Yee K.K., Dalton P., Ding X., Finel M.
    Pharmacogenet. Genomics 19:923-934(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, TISSUE SPECIFICITY.
    Tissue: Nasal mucosa.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5), VARIANTS LYS-75 AND ILE-391.
    Tissue: Trachea.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiUD2A1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y4X1
Secondary accession number(s): B4E2F4
, D3GER1, D3GER2, E9PDM7, J3KNA3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2003
Last sequence update: May 18, 2010
Last modified: November 26, 2014
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3