Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UDP-glucuronosyltransferase 2A1

Gene

UGT2A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. Active on odorants and seems to be involved in olfaction; it could help clear lipophilic odorant molecules from the sensory epithelium.1 Publication

Catalytic activityi

UDP-glucuronate + acceptor = UDP + acceptor beta-D-glucuronoside.

Kineticsi

  1. KM=75.4 µM for 3-hydroxybiphenyl1 Publication
  2. KM=59.5 µM for umbelliferone1 Publication
  3. KM=51.6 µM for S---b-citronellol1 Publication
  4. KM=170.1 µM for borneol1 Publication
  5. KM=56.2 µM for testosterone1 Publication
  6. KM=251 µM for UDP-glucuronate1 Publication
  1. Vmax=2.60 nmol/min/mg enzyme with 3-hydroxybiphenyl as substrate1 Publication
  2. Vmax=0.61 nmol/min/mg enzyme with umbelliferone as substrate1 Publication
  3. Vmax=1.98 nmol/min/mg enzyme with S---b-citronellol as substrate1 Publication
  4. Vmax=1.05 nmol/min/mg enzyme with borneol as substrate1 Publication
  5. Vmax=0.25 nmol/min/mg enzyme with testosterone as substrate1 Publication

GO - Molecular functioni

  • glucuronosyltransferase activity Source: UniProtKB

GO - Biological processi

  • cellular glucuronidation Source: BHF-UCL
  • detection of chemical stimulus Source: ProtInc
  • metabolic process Source: ProtInc
  • sensory perception of smell Source: UniProtKB-KW

Keywordsi

Molecular functionGlycosyltransferase, Transferase
Biological processOlfaction, Sensory transduction

Enzyme and pathway databases

ReactomeiR-HSA-156588. Glucuronidation.

Protein family/group databases

CAZyiGT1. Glycosyltransferase Family 1.

Chemistry databases

SwissLipidsiSLP:000001706.
SLP:000001712. [Q9Y4X1-2]

Names & Taxonomyi

Protein namesi
Recommended name:
UDP-glucuronosyltransferase 2A1 (EC:2.4.1.17)
Short name:
UDPGT 2A1
Gene namesi
Name:UGT2A1
Synonyms:UGT2A2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000173610.12.
HostDB:ENSG00000271271.5.
HGNCiHGNC:12542. UGT2A1.
HGNC:28183. UGT2A2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini21 – 490ExtracellularSequence analysisAdd BLAST470
Transmembranei491 – 507HelicalSequence analysisAdd BLAST17
Topological domaini508 – 527CytoplasmicSequence analysisAdd BLAST20

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi10941.
574537.
PharmGKBiPA37184.

Chemistry databases

ChEMBLiCHEMBL1743321.

Polymorphism and mutation databases

BioMutaiUGT2A1.
DMDMi296452854.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 20Sequence analysisAdd BLAST20
ChainiPRO_000003602321 – 527UDP-glucuronosyltransferase 2A1Add BLAST507

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi49N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi313N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi347N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PeptideAtlasiQ9Y4X1.
PRIDEiQ9Y4X1.

PTM databases

iPTMnetiQ9Y4X1.
PhosphoSitePlusiQ9Y4X1.

Expressioni

Tissue specificityi

Olfactory epithelium and brain. Isoform 2 is mainly expressed in the nasal mucosa.2 Publications

Gene expression databases

BgeeiENSG00000173610.
CleanExiHS_UGT2A1.
ExpressionAtlasiQ9Y4X1. baseline and differential.
GenevisibleiQ9Y4X1. HS.

Organism-specific databases

HPAiHPA017261.
HPA045108.

Interactioni

Protein-protein interaction databases

BioGridi300002. 1 interactor.

Structurei

3D structure databases

ProteinModelPortaliQ9Y4X1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the UDP-glycosyltransferase family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00760000118949.
HOGENOMiHOG000220831.
HOVERGENiHBG004033.
InParanoidiQ9Y4X1.
KOiK00699.
OMAiFQDADIW.
OrthoDBiEOG091G06JC.
PhylomeDBiQ9Y4X1.
TreeFamiTF315472.

Family and domain databases

InterProiView protein in InterPro
IPR002213. UDP_glucos_trans.
IPR035595. UDP_glycos_trans_CS.
PANTHERiPTHR11926. PTHR11926. 1 hit.
PfamiView protein in Pfam
PF00201. UDPGT. 1 hit.
PROSITEiView protein in PROSITE
PS00375. UDPGT. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y4X1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLNNLLLFSL QISLIGTTLG GNVLIWPMEG SHWLNVKIII DELIKKEHNV
60 70 80 90 100
TVLVASGALF ITPTSNPSLT FEIYRVPFGK ERIEGVIKDF VLTWLENRPS
110 120 130 140 150
PSTIWRFYQE MAKVIKDFHM VSQEICDGVL KNQQLMAKLK KSKFEVLVSD
160 170 180 190 200
PVFPCGDIVA LKLGIPFMYS LRFSPASTVE KHCGKVPYPP SYVPAVLSEL
210 220 230 240 250
TDQMSFTDRI RNFISYHLQD YMFETLWKSW DSYYSKALGR PTTLCETMGK
260 270 280 290 300
AEIWLIRTYW DFEFPRPYLP NFEFVGGLHC KPAKPLPKEM EEFIQSSGKN
310 320 330 340 350
GVVVFSLGSM VKNLTEEKAN LIASALAQIP QKVLWRYKGK KPATLGNNTQ
360 370 380 390 400
LFDWIPQNDL LGHPKTKAFI THGGTNGIYE AIYHGVPMVG VPMFADQPDN
410 420 430 440 450
IAHMKAKGAA VEVNLNTMTS VDLLSALRTV INEPSYKENA MRLSRIHHDQ
460 470 480 490 500
PVKPLDRAVF WIEFVMRHKG AKHLRVAAHD LTWFQYHSLD VIGFLLVCVT
510 520
TAIFLVIQCC LFSCQKFGKI GKKKKRE
Length:527
Mass (Da):59,926
Last modified:May 18, 2010 - v2
Checksum:iC55858D7185273A8
GO
Isoform 2 (identifier: Q9Y4X1-2) [UniParc]FASTAAdd to basket
Also known as: UGT2A2

The sequence of this isoform differs from the canonical sequence as follows:
     1-237: MLNNLLLFSL...KSWDSYYSKA → MVSIRDFTMP...GEWNSYYSKI

Show »
Length:536
Mass (Da):60,772
Checksum:i2234435E46224749
GO
Isoform 3 (identifier: Q9Y4X1-3) [UniParc]FASTAAdd to basket
Also known as: UGT2A2 variant 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-237: MLNNLLLFSL...KSWDSYYSKA → MVSIRDFTMP...GEWNSYYSKI
     288-331: Missing.

Show »
Length:492
Mass (Da):56,053
Checksum:i4A3E94D5433A9289
GO
Isoform 4 (identifier: Q9Y4X1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-237: A → ALDGSHWLNI...GEWNSYYSKI
     288-331: Missing.

Note: No experimental confirmation available.
Show »
Length:693
Mass (Da):79,091
Checksum:i7310B7229C9E2AA1
GO
Isoform 5 (identifier: Q9Y4X1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     238-238: L → LGGLLLCCPGWSAVADLGSLQPLLPGFKRFSRLSLHCSWDYRLPA
     288-331: Missing.

Note: No experimental confirmation available.
Show »
Length:527
Mass (Da):59,991
Checksum:iB5E0848AD4D14497
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti92L → S in CAB41974 (PubMed:10359671).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06311375R → K2 PublicationsCorresponds to variant dbSNP:rs1347046Ensembl.1
Natural variantiVAR_024686308G → R. Corresponds to variant dbSNP:rs4148301Ensembl.1
Natural variantiVAR_057326391V → I1 PublicationCorresponds to variant dbSNP:rs4148304Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0393751 – 237MLNNL…YYSKA → MVSIRDFTMPKKFVQMLVFN LTLTEVVLSGNVLIWPTDGS HWLNIKIILEELIQRNHNVT VLASSATLFINSNPDSPVNF EVIPVSYKKSNIDSLIEHMI MLWIDHRPTPLTIWAFYKEL GKLLDTFFQINIQLCDGVLK NPKLMARLQKGGFDVLVADP VTICGDLVALKLGIPFMYTL RFSPASTVERHCGKIPAPVS YVPAALSELTDQMTFGERIK NTISYSLQDYIFQSYWGEWN SYYSKI in isoform 2 and isoform 3. 1 PublicationAdd BLAST237
Alternative sequenceiVSP_044733237A → ALDGSHWLNIKIILEELIQR NHNVTVLASSATLFINSNPD SPVNFEVIPVSYKKSNIDSL IEHMIMLWIDHRPTPLTIWA FYKELGKLLDTFFQINIQLC DGVLKNPKLMARLQKGGFDV LVADPVTICGDLVALKLGIP FMYTLRFSPASTVERHCGKI PAPVSYVPAALSELTDQMTF GERIKNTISYSLQDYIFQSY WGEWNSYYSKI in isoform 4. 1 Publication1
Alternative sequenceiVSP_045577238L → LGGLLLCCPGWSAVADLGSL QPLLPGFKRFSRLSLHCSWD YRLPA in isoform 5. 1 Publication1
Alternative sequenceiVSP_039376288 – 331Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ006054 mRNA. Translation: CAB41974.1.
FJ664272 mRNA. Translation: ACV70034.1.
FJ664273 mRNA. Translation: ACV70035.1.
AK304249 mRNA. Translation: BAG65116.1.
AK314209 mRNA. No translation available.
AC093829 Genomic DNA. No translation available.
CCDSiCCDS3529.1. [Q9Y4X1-1]
CCDS58901.1. [Q9Y4X1-5]
CCDS58902.1. [Q9Y4X1-4]
RefSeqiNP_001099147.2. NM_001105677.2. [Q9Y4X1-2]
NP_001239203.2. NM_001252274.2.
NP_001239204.2. NM_001252275.2.
NP_001288162.1. NM_001301233.1. [Q9Y4X1-3]
NP_001288168.1. NM_001301239.1.
NP_006789.3. NM_006798.4.
UniGeneiHs.225950.

Genome annotation databases

EnsembliENST00000286604; ENSP00000286604; ENSG00000173610.
ENST00000457664; ENSP00000387888; ENSG00000173610.
ENST00000503640; ENSP00000424478; ENSG00000173610.
ENST00000604021; ENSP00000474383; ENSG00000271271. [Q9Y4X1-3]
ENST00000604629; ENSP00000475028; ENSG00000271271. [Q9Y4X1-2]
GeneIDi10941.
574537.
KEGGihsa:10941.
hsa:574537.
UCSCiuc003hem.4. human. [Q9Y4X1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiUD2A1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y4X1
Secondary accession number(s): B4E2F4
, D3GER1, D3GER2, E9PDM7, J3KNA3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2003
Last sequence update: May 18, 2010
Last modified: September 27, 2017
This is version 146 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

According to HGNC, UGT2A1 and UGT2A2 are 2 separate genes. However, they share common exons at the C-terminus, suggesting that UGT2A1 and UGT2A2 are different isoforms encoded by the same locus.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families