Reviewed,
UniProtKB/Swiss-Prot Q9Y4P1 (ATG4B_HUMAN)
Last modified
November 4, 2008.
Version 68.
History...
Clusters with 100%,
90%,
50% identity |
Documents (8) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Cysteine protease ATG4B EC=3.4.22.- Alternative name(s): Autophagy-related protein 4 homolog B Short name=hAPG4B Autophagin-1 Autophagy-related cysteine endopeptidase 1 AUT-like 1 cysteine endopeptidase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 393 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Cysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes. |
| Enzyme regulation | Inhibited by N-ethylmaleimide. |
| Subcellular location | CytoplasmProbable. |
| Tissue specificity | Mainly expressed in the skeletal muscle, followed by brain, heart, liver and pancreas. |
| Sequence similarities | Belongs to the peptidase C54 family. |
Ontologies
Keywords | |
|---|---|
| Biological process | Autophagy Protein transport Transport Ubl conjugation pathway |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Hydrolase Protease Thiol protease |
| PTM | Phosphoprotein |
| Technical term | 3D-structure |
Gene Ontology (GO) | |
| Biological process | autophagosome formation Ref.1 Inferred from sequence or structural similarity. Source: UniProtKB protein targeting to membrane Ref.1Inferred from sequence or structural similarity. Source: UniProtKB proteolysis Ref.2Inferred from direct assay. Source: UniProtKB |
| Cellular component | cytosol Ref.1 Inferred from sequence or structural similarity. Source: UniProtKB microtubule associated complex Ref.1Inferred from sequence or structural similarity. Source: UniProtKB |
| Molecular function | cysteine-type peptidase activity Ref.2 Inferred from direct assay. Source: UniProtKB protein binding Ref.1Inferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y4P1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y4P1-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAHSVPSDSR...GSVGGRTGKM 370-393: DSSDVERLERFFDSEDEDFEILSL → GESCQVQILLM | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9Y4P1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-74: Missing. 321-354: FFCKTEDDFNDWCQQVKKLSLLGGALPMFELVEQ → KQGRLVRSLIPWAPRPSSWCAAVLGAAVVMCGTP 355-393: Missing. | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9Y4P1-4) The sequence of this isoform differs from the canonical sequence as follows: 1-74: Missing. 369-369: L → LGESCQVQVGSLG | ||||||
| Isoform 6 (identifier: Q9Y4P1-6) The sequence of this isoform differs from the canonical sequence as follows: 370-393: DSSDVERLERFFDSEDEDFEILSL → GESCQVQILLM | ||||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 393 | 393 | Cysteine protease ATG4B | PRO_0000215844 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 74 | 1 | Nucleophile | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 278 | 1 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 280 | 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 34 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 316 | 1 | Phosphoserine | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 383 | 1 | Phosphoserine | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 392 | 1 | Phosphoserine | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 74 | 74 | Missing in isoform 3 and isoform 4. | VSP_013028 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MAHSVPSDSRTSRRPTTRPH AARGAPRGSRRPGRTPKWRL PRISARAPYRLRRLRRHTYW PPRRPVAASRCWPVGATPLG SVGGRTGKM in isoform 2. | VSP_013029 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 321 – 354 | 34 | FFCKT…ELVEQ → KQGRLVRSLIPWAPRPSSWC AAVLGAAVVMCGTP in isoform 3. | VSP_013031 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 355 – 393 | 39 | Missing in isoform 3. | VSP_013032 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 369 | 1 | L → LGESCQVQVGSLG in isoform 4. | VSP_013033 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 370 – 393 | 24 | DSSDV…EILSL → GESCQVQILLM in isoform 2 and isoform 6. | VSP_013034 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 354 | 1 | Q → L: dbSNP rs7601000. | VAR_021486 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 74 | 1 | C → S: Complete loss of protease activity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 142 | 1 | W → A: Strongly reduced protease activity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 229 | 1 | R → A: Strongly reduced protease activity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 278 | 1 | D → A: Complete loss of protease activity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 280 | 1 | H → A: Complete loss of protease activity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 136 | 1 | Missing in BAB83890. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 188 | 1 | P → L in BAB55127. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 247 | 1 | F → Y in BAB55353. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 273 | 1 | E → G in BAB55042. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 312 | 1 | E → N in BAB83890. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 10 – 13 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 26 – 28 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 31 – 33 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 35 – 37 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 39 – 48 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 54 – 57 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 61 – 64 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 70 – 72 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 74 – 91 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 106 – 113 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 116 – 118 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 125 – 133 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 134 – 136 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 145 – 156 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 160 – 162 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 165 – 168 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 173 – 175 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 176 – 183 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 184 – 186 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 222 – 229 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 232 – 234 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 237 – 239 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 240 – 246 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 252 – 257 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 264 – 270 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 273 – 277 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 281 – 284 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 297 – 299 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 306 – 309 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 310 – 312 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 315 – 325 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 326 – 341 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 349 – 353 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 364 – 370 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 371 – 376 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human autophagins, a family of cysteine proteinases potentially implicated in cell degradation by autophagy." Marino G., Uria J.A., Puente X.S., Quesada V., Bordallo J., Lopez-Otin C. J. Biol. Chem. 278:3671-3678(2003) [PubMed: 12446702] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Liver. |
| [2] | "LC3, GABARAP and GATE16 localize to autophagosomal membrane depending on form-II formation." Kabeya Y., Mizushima N., Yamamoto A., Oshitani-Okamoto S., Ohsumi Y., Yoshimori T. J. Cell Sci. 117:2805-2812(2004) [PubMed: 15169837] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, FUNCTION IN GABARAPL2; GABARAP AND MAP1LC3A CLEAVAGE, MUTAGENESIS OF CYS-74. |
| [3] | "Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 6:63-70(1999) [PubMed: 10231032] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | Ohara O., Nagase T., Kikuno R. Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., |

Clusters with