Q9Y4J8 (DTNA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dystrobrevin alpha Short name=DTN-A Alternative name(s): Alpha-dystrobrevin Dystrophin-related protein 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 743 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be involved in the formation and stability of synapses as well as being involved in the clustering of nicotinic acetylcholine receptors. |
| Subunit structure | Interacts with dystrophin, utrophin and the syntrophins SNTA1, SNTB1, SNTB2, SNTG1 and SNTG2. Isoform 7 and isoform 8 do not interact with dystrophin. Binds dystrobrevin binding protein 1. Interacts with MAGEE1 By similarity. Ref.9 Ref.10 Ref.11 |
| Subcellular location | Cytoplasm. Cell junction › synapse. Cell membrane By similarity. Note: In peripheral nerves, co-localizes with MAGEE1 in the Schwann cell membrane By similarity. |
| Tissue specificity | Highly expressed in brain, skeletal and cardiac muscles, and expressed at lower levels in lung, liver and pancreas. Isoform 2 is not expressed in cardiac muscle. Isoform 7 and isoform 8 are only expressed in muscle. |
| Domain | The coiled coil domain mediates the interaction with dystrophin and utrophin By similarity. |
| Post-translational modification | Phosphorylation of DTN-1 on tyrosine kinase substrate domain present in the C-terminus By similarity. |
| Involvement in disease | Left ventricular non-compaction 1 (LVNC1) [MIM:604169]: A disease due to an arrest of myocardial morphogenesis. It is characterized by a hypertrophic left ventricule with deep trabeculations and with poor systolic function, with or without associated left ventricular dilation. In some cases, it is associated with other congenital heart anomalies such as ventricular septal defects, pulmonic stenosis and atrial septal defects. The right ventricle may also be affected. |
| Sequence similarities | Belongs to the dystrophin family. Dystrobrevin subfamily. Contains 1 ZZ-type zinc finger. |
Ontologies
Alternative products
| This entry describes 11 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q9Y4J8-1) Also known as: DTN-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y4J8-2) Also known as: Dystrobrevin-alpha; The sequence of this isoform differs from the canonical sequence as follows: 366-422: Missing. | ||||||
| Isoform 3 (identifier: Q9Y4J8-3) Also known as: DTN-2; The sequence of this isoform differs from the canonical sequence as follows: 555-570: TQGAGSPRSSPSHTIS → EEELKQGVSYVPYCRS 571-743: Missing. | ||||||
| Isoform 4 (identifier: Q9Y4J8-4) Also known as: Dystrobrevin-beta; The sequence of this isoform differs from the canonical sequence as follows: 335-337: Missing. 555-570: TQGAGSPRSSPSHTIS → EEELKQGVSYVPYCRS 571-743: Missing. | ||||||
| Isoform 5 (identifier: Q9Y4J8-5) Also known as: Dystrobrevin-gamma; The sequence of this isoform differs from the canonical sequence as follows: 366-422: Missing. 555-570: TQGAGSPRSSPSHTIS → EEELKQGVSYVPYCRS 571-743: Missing. | ||||||
| Isoform 6 (identifier: Q9Y4J8-6) Also known as: Dystrobrevin-epsilon; The sequence of this isoform differs from the canonical sequence as follows: 1-318: Missing. 335-337: Missing. 392-422: Missing. | ||||||
| Isoform 7 (identifier: Q9Y4J8-7) Also known as: DTN-3; Alpha-dystrobrevin-3; Dystrobrevin-delta; The sequence of this isoform differs from the canonical sequence as follows: 367-374: PPKDSEVE → DGAFGGCV 375-743: Missing. | ||||||
| Isoform 8 (identifier: Q9Y4J8-8) Also known as: Dystrobrevin-zeta; The sequence of this isoform differs from the canonical sequence as follows: 1-318: Missing. 335-337: Missing. 366-422: Missing. 555-570: TQGAGSPRSSPSHTIS → EEELKQGVSYVPYCRS 571-743: Missing. | ||||||
| Isoform 9 (identifier: Q9Y4J8-9) The sequence of this isoform differs from the canonical sequence as follows: 335-337: Missing. 367-374: PPKDSEVE → DGAFGGCV 375-743: Missing. | ||||||
| Isoform 10 (identifier: Q9Y4J8-10) The sequence of this isoform differs from the canonical sequence as follows: 1-318: Missing. 335-337: Missing. 365-422: SSPPKDSEVE...VNMLRNNPSC → RLPEGISASSPVAEEHSLIKLYVNQLDHGAR | ||||||
| Isoform 11 (identifier: Q9Y4J8-11) The sequence of this isoform differs from the canonical sequence as follows: 1-318: Missing. 335-337: Missing. 364-365: RS → RRLPEGISASSPVAEEHSLIKLYVNQLDHGAR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||
Molecule processing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 743 | 743 | Dystrobrevin alpha | PRO_0000080036 | |||||||||||||||
Regions | |||||||||||||||||||
| Zinc finger | 237 – 284 | 48 | ZZ-type | ||||||||||||||||
| Region | 1 – 288 | 288 | Interaction with MAGEE1 By similarity | ||||||||||||||||
| Region | 400 – 450 | 51 | Syntrophin-binding region | ||||||||||||||||
| Coiled coil | 461 – 556 | 96 | Potential | ||||||||||||||||
Natural variations | |||||||||||||||||||
| Alternative sequence | 1 – 318 | 318 | Missing in isoform 6, isoform 8, isoform 10 and isoform 11. | VSP_004206 | |||||||||||||||
| Alternative sequence | 335 – 337 | 3 | Missing in isoform 4, isoform 6, isoform 8, isoform 9, isoform 10 and isoform 11. | VSP_004207 | |||||||||||||||
| Alternative sequence | 364 – 365 | 2 | RS → RRLPEGISASSPVAEEHSLI KLYVNQLDHGAR in isoform 11. | VSP_045444 | |||||||||||||||
| Alternative sequence | 365 – 422 | 58 | SSPPK…NNPSC → RLPEGISASSPVAEEHSLIK LYVNQLDHGAR in isoform 10. | VSP_043824 | |||||||||||||||
| Alternative sequence | 366 – 422 | 57 | Missing in isoform 2, isoform 5 and isoform 8. | VSP_004208 | |||||||||||||||
| Alternative sequence | 367 – 374 | 8 | PPKDSEVE → DGAFGGCV in isoform 7 and isoform 9. | VSP_004209 | |||||||||||||||
| Alternative sequence | 375 – 743 | 369 | Missing in isoform 7 and isoform 9. | VSP_004210 | |||||||||||||||
| Alternative sequence | 392 – 422 | 31 | Missing in isoform 6. | VSP_004211 | |||||||||||||||
| Alternative sequence | 555 – 570 | 16 | TQGAG…SHTIS → EEELKQGVSYVPYCRS in isoform 3, isoform 4, isoform 5 and isoform 8. | VSP_004212 | |||||||||||||||
| Alternative sequence | 571 – 743 | 173 | Missing in isoform 3, isoform 4, isoform 5 and isoform 8. | VSP_004213 | |||||||||||||||
| Natural variant | 121 | 1 | P → L in LVNC1. Ref.14 | VAR_026744 | |||||||||||||||
| Natural variant | 180 | 1 | A → E. Ref.1 Ref.2 Corresponds to variant rs1048081 [ dbSNP | Ensembl ]. | VAR_055320 | |||||||||||||||
Experimental info | |||||||||||||||||||
| Sequence conflict | 45 | 1 | Q → H in AAB58541. Ref.2 | ||||||||||||||||
| Sequence conflict | 45 | 1 | Q → H in AAB58542. Ref.2 | ||||||||||||||||
| Sequence conflict | 45 | 1 | Q → H in AAB58543. Ref.2 | ||||||||||||||||
| Sequence conflict | 64 | 1 | E → K in CAA08769. Ref.3 | ||||||||||||||||
| Sequence conflict | 182 | 1 | F → L in AAC50426. Ref.1 | ||||||||||||||||
| Sequence conflict | 182 | 1 | F → L in AAB58541. Ref.2 | ||||||||||||||||
| Sequence conflict | 182 | 1 | F → L in AAB58542. Ref.2 | ||||||||||||||||
| Sequence conflict | 182 | 1 | F → L in AAB58543. Ref.2 | ||||||||||||||||
| Sequence conflict | 314 | 1 | E → K in AAC50430. Ref.1 | ||||||||||||||||
| Sequence conflict | 558 – 561 | 4 | AGSP → SGTH in AAC50429. Ref.1 | ||||||||||||||||
| Sequence conflict | 558 – 559 | 2 | AG → GV in AAC50431. Ref.1 | ||||||||||||||||
| Sequence conflict | 565 | 1 | P → R in AAC50429. Ref.1 | ||||||||||||||||
| Sequence conflict | 568 | 1 | T → S in AAC50429. Ref.1 | ||||||||||||||||
| Sequence conflict | 689 | 1 | T → S in AAC50429. Ref.1 | ||||||||||||||||
Secondary structure | |||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||
| Beta strand | 244 – 246 | 3 | |||||||||||||||||
| Beta strand | 255 – 260 | 6 | |||||||||||||||||
| Helix | 268 – 273 | 6 | |||||||||||||||||
| Beta strand | 278 – 280 | 3 | |||||||||||||||||
| Beta strand | 286 – 289 | 4 | |||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of the human homologue of a dystrophin related phosphoprotein found at the Torpedo electric organ post-synaptic membrane." Sadoulet-Puccio H.M., Khurana T.S., Cohen J.B., Kunkel L.M. Hum. Mol. Genet. 5:489-496(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 4; 5; 6; 7 AND 8), VARIANT GLU-180. |
| [2] | "The genomic organization of human dystrobrevin." Sadoulet-Puccio H.M., Feener C.A., Schaid D.J., Thibodeau S.N., Michels V.V., Kunkel L.M. Neurogenetics 1:37-42(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 3 AND 7), VARIANT GLU-180. |
| [3] | "Characterisation of alpha-dystrobrevin in muscle." Nawrotzki R., Loh N.Y., Ruegg M.A., Davies K.E., Blake D.J. J. Cell Sci. 111:2595-2605(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7). Tissue: Fetal brain. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 10 AND 11). Tissue: Hippocampus. |
| [6] | "DNA sequence and analysis of human chromosome 18." Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J. Lander E.S.Nature 437:551-555(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9). Tissue: Heart. |
| [9] | "Syntrophin binds to an alternatively spliced exon of dystrophin." Ahn A.H., Kunkel L.M. J. Cell Biol. 128:363-371(1995) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SNTB1. |
| [10] | "The three human syntrophin genes are expressed in diverse tissues, have distinct chromosomal locations, and each bind to dystrophin and its relatives." Ahn A.H., Feener C.A., Gussoni E., Yoshida M., Ozawa E., Kunkel L.M. J. Biol. Chem. 271:2724-2730(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SNTA1 AND SNTB2. |
| [11] | "Gamma1- and gamma2-syntrophins, two novel dystrophin-binding proteins localized in neuronal cells." Piluso G., Mirabella M., Ricci E., Belsito A., Abbondanza C., Servidei S., Puca A.A., Tonali P., Puca G.A., Nigro V. J. Biol. Chem. 275:15851-15860(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SNTG1 AND SNTG2. |
| [12] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [13] | "Solution structure of the ZZ domain of dystrobrevin alpha." RIKEN structural genomics initiative (RSGI) Submitted (JUN-2007) to the PDB data bank Cited for: STRUCTURE BY NMR OF 237-292. |
| [14] | "Novel gene mutations in patients with left ventricular noncompaction or Barth syndrome." Ichida F., Tsubata S., Bowles K.R., Haneda N., Uese K., Miyawaki T., Dreyer W.J., Messina J., Li H., Bowles N.E., Towbin J.A. Circulation 103:1256-1263(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LVNC1 LEU-121. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U46744 mRNA. Translation: AAC50429.1. U46745 mRNA. Translation: AAC50430.1. U26744 mRNA. Translation: AAC50426.1. U46746 mRNA. Translation: AAC50431.1. U26742 mRNA. Translation: AAC50424.1. U26743 mRNA. Translation: AAC50425.1. AK295732 mRNA. Translation: BAG58572.1. AK295789 mRNA. Translation: BAG58610.1. U84551 U84550 Genomic DNA. Translation: AAB58543.1.U84547 U84545 Genomic DNA. Translation: AAB58542.1.U84540 U84538 Genomic DNA. Translation: AAB58541.1.AJ009668 mRNA. Translation: CAA08769.1. BT006937 mRNA. Translation: AAP35583.1. AC068506 Genomic DNA. No translation available. AC022601 Genomic DNA. No translation available. AC103768 Genomic DNA. No translation available. AC013290 Genomic DNA. No translation available. CH471088 Genomic DNA. Translation: EAX01328.1. BC005300 mRNA. Translation: AAH05300.1. | ||||||||||||
| IPI | IPI00177936. IPI00218653. IPI00218655. IPI00296091. IPI00402365. IPI00749235. IPI00929645. IPI00938014. IPI00942739. | ||||||||||||
| RefSeq | NP_001121647.1. NM_001128175.1. NP_001185867.1. NM_001198938.1. NP_001185868.1. NM_001198939.1. NP_001185871.1. NM_001198942.1. NP_001185873.1. NM_001198944.1. NP_001381.2. NM_001390.4. NP_001382.2. NM_001391.5. NP_001383.2. NM_001392.4. NP_116757.2. NM_032975.3. NP_116760.2. NM_032978.6. NP_116761.2. NM_032979.4. NP_116762.2. NM_032980.3. NP_116763.1. NM_032981.4. | ||||||||||||
| UniGene | Hs.643454. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9Y4J8. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9Y4J8. 5 interactions. | ||||||||||||
| MINT | MINT-129318. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9Y4J8. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 229462840. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9Y4J8. | ||||||||||||
| PRIDE | Q9Y4J8. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 1837. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000269191; ENSP00000269191; ENSG00000134769. ENST00000269192; ENSP00000269192; ENSG00000134769. ENST00000283365; ENSP00000283365; ENSG00000134769. ENST00000315456; ENSP00000322519; ENSG00000134769. ENST00000348997; ENSP00000336682; ENSG00000134769. ENST00000399097; ENSP00000382048; ENSG00000134769. ENST00000399113; ENSP00000382064; ENSG00000134769. ENST00000444659; ENSP00000405819; ENSG00000134769. ENST00000554864; ENSP00000451516; ENSG00000134769. ENST00000556414; ENSP00000452255; ENSG00000134769. ENST00000591182; ENSP00000467720; ENSG00000134769. ENST00000597674; ENSP00000471783; ENSG00000134769. ENST00000598142; ENSP00000470716; ENSG00000134769. ENST00000598774; ENSP00000472031; ENSG00000134769. | ||||||||||||
| GeneID | 1837. | ||||||||||||
| KEGG | hsa:1837. | ||||||||||||
| UCSC | uc002kxu.2. human. uc002kxv.4. human. uc002kxw.2. human. uc002kyb.4. human. uc002kyd.4. human. uc002kye.3. human. uc010dmm.3. human. uc010dmn.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 1837. | ||||||||||||
| GeneCards | GC18P032073. | ||||||||||||
| HGNC | HGNC:3057. DTNA. | ||||||||||||
| HPA | CAB015196. | ||||||||||||
| MIM | 601239. gene. 604169. phenotype. | ||||||||||||
| neXtProt | NX_Q9Y4J8. | ||||||||||||
| Orphanet | 54260. Left ventricular noncompaction. | ||||||||||||
| PharmGKB | PA27510. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG251970. | ||||||||||||
| HOGENOM | HOG000230684. | ||||||||||||
| HOVERGEN | HBG005539. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9Y4J8. | ||||||||||||
| Bgee | Q9Y4J8. | ||||||||||||
| Genevestigator | Q9Y4J8. | ||||||||||||
| GermOnline | ENSG00000134769. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.238.10. 2 hits. | ||||||||||||
| InterPro | IPR017432. Distrobrevin. IPR011992. EF-hand-like_dom. IPR015153. EF-hand_dom_typ1. IPR015154. EF-hand_dom_typ2. IPR000433. Znf_ZZ. [Graphical view] | ||||||||||||
| Pfam | PF09068. efhand_1. 1 hit. PF09069. efhand_2. 1 hit. PF00569. ZZ. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF038204. Distrobrevin. 1 hit. | ||||||||||||
| SMART | SM00291. ZnF_ZZ. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS01357. ZF_ZZ_1. 1 hit. PS50135. ZF_ZZ_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | DTNA. human. | ||||||||||||
| EvolutionaryTrace | Q9Y4J8. | ||||||||||||
| GenomeRNAi | 1837. | ||||||||||||
| NextBio | 7499. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | DTNA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y4J8 Secondary accession number(s): A8MSZ0 Q9BS59 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
