Q9Y4F1 (FARP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: FERM, RhoGEF and pleckstrin domain-containing protein 1 Alternative name(s): Chondrocyte-derived ezrin-like protein Pleckstrin homology domain-containing family C member 2 Short name=PH domain-containing family C member 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1045 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions as guanine nucleotide exchange factor for RAC1. May play a role in semaphorin signaling. Plays a role in the assembly and disassembly of dendritic filopodia, the formation of dendritic spines, regulation of dendrite length and ultimately the formation of synapses By similarity. |
| Subunit structure | Interacts with CADM1. Interacts with RAC1 By similarity. |
| Subcellular location | Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell junction › synapse. Cell junction › synapse › synaptosome By similarity. Cytoplasm › cytosol By similarity. Cell projection › filopodium By similarity. Cell projection › dendrite By similarity. Cell projection › dendritic spine By similarity. Note: Recruited to the cell membrane via interaction with CADM1 By similarity. |
| Tissue specificity | Detected in cAMP-treated chondrocytes, but not in untreated chondrocytes. Detected in fetal brain, heart and spleen, and in adult testis, kidney and lung. Ref.1 |
| Induction | Up-regulated in response to cAMP in cultured embryonic chondrocytes. Ref.1 |
| Domain | Intramolecular interaction between the DH domain and the PH domains can stabilize the protein in an autoinhibited conformation. Ref.12 |
| Sequence similarities | Contains 1 DH (DBL-homology) domain. Contains 1 FERM domain. Contains 2 PH domains. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y4F1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y4F1-2) The sequence of this isoform differs from the canonical sequence as follows: 758-758: R → RPGSFSLMRTPHLGQARRIPCAPERRPLLLVK | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9Y4F1-3) The sequence of this isoform differs from the canonical sequence as follows: 58-129: QRAPGKVLLD...FPPDHTQLQE → MVSSSSFLKA...TVTEELLNLF 130-1045: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1045 | 1045 | FERM, RhoGEF and pleckstrin domain-containing protein 1 | PRO_0000232753 | |||||
Regions | |||||||||
| Domain | 40 – 320 | 281 | FERM | ||||||
| Domain | 540 – 730 | 191 | DH | ||||||
| Domain | 759 – 856 | 98 | PH 1 | ||||||
| Domain | 932 – 1029 | 98 | PH 2 | ||||||
| Compositional bias | 449 – 453 | 5 | Poly-Glu | ||||||
Amino acid modifications | |||||||||
| Modified residue | 24 | 1 | Phosphothreonine Ref.7 Ref.9 | ||||||
| Modified residue | 340 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 427 | 1 | Phosphoserine Ref.5 Ref.6 Ref.9 | ||||||
| Modified residue | 510 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 514 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 872 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 889 | 1 | Phosphoserine Ref.8 Ref.11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 58 – 129 | 72 | QRAPG…TQLQE → MVSSSSFLKATGSSWTGWVL RCSMKPKHHSHLIEKFGEDR ILTHLTGSISYTNWAGSRSL AVTVTEELLNLF in isoform 3. | VSP_040989 | |||||
| Alternative sequence | 130 – 1045 | 916 | Missing in isoform 3. | VSP_040990 | |||||
| Alternative sequence | 758 | 1 | R → RPGSFSLMRTPHLGQARRIP CAPERRPLLLVK in isoform 2. | VSP_017976 | |||||
| Natural variant | 8 | 1 | P → L. Corresponds to variant rs9300466 [ dbSNP | Ensembl ]. | VAR_048362 | |||||
| Natural variant | 714 | 1 | R → L in a breast cancer sample; somatic mutation. Ref.13 | VAR_035851 | |||||
Experimental info | |||||||||
| Sequence conflict | 644 | 1 | H → Y in AAH71592. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of CDEP, a novel human protein containing the ezrin-like domain of the band 4.1 superfamily and the Dbl homology domain of rho guanine nucleotide exchange factors." Koyano Y., Kawamoto T., Shen M., Yan W., Noshiro M., Fujii K., Kato Y. Biochem. Biophys. Res. Commun. 241:369-375(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INDUCTION, TISSUE SPECIFICITY. Tissue: Cartilage. |
| [2] | "The DNA sequence and analysis of human chromosome 13." Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. Ross M.T.Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Brain, Placenta and Skin. |
| [4] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [5] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-427, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [6] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-427, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-24 AND SER-340, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography." Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J. Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-889, MASS SPECTROMETRY. Tissue: Liver. |
| [9] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-24; SER-427; SER-510 AND SER-514, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-872 AND SER-889, MASS SPECTROMETRY. |
| [12] | "Structural basis for autoinhibition of the guanine nucleotide exchange factor FARP2." He X., Kuo Y.C., Rosche T.J., Zhang X. Structure 21:355-364(2013) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (4.09 ANGSTROMS) OF 539-1035, DOMAIN. |
| [13] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] LEU-714. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB008430 mRNA. Translation: BAA24267.1. AL136300, AL445223 Genomic DNA. Translation: CAI10952.1. AL136300, AL137249, AL161896 Genomic DNA. Translation: CAI10953.1. AL161896, AL136300, AL137249 Genomic DNA. Translation: CAI12946.1. AL445223, AL136300 Genomic DNA. Translation: CAI15981.1. AL137249, AL136300, AL161896 Genomic DNA. Translation: CAI39458.1. BC041595 mRNA. Translation: AAH41595.1. BC065020 mRNA. No translation available. BC071592 mRNA. Translation: AAH71592.1. | ||||||||||||
| IPI | IPI00024773. IPI00418590. IPI00746455. | ||||||||||||
| PIR | JC5795. | ||||||||||||
| RefSeq | NP_001001715.2. NM_001001715.2. NP_005757.1. NM_005766.2. | ||||||||||||
| UniGene | Hs.403917. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9Y4F1. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9Y4F1. 1 interaction. | ||||||||||||
| STRING | 9606.ENSP00000322926. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9Y4F1. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74762059. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9Y4F1. | ||||||||||||
| PRIDE | Q9Y4F1. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 10160. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000319562; ENSP00000322926; ENSG00000152767. ENST00000376581; ENSP00000365765; ENSG00000152767. | ||||||||||||
| GeneID | 10160. | ||||||||||||
| KEGG | hsa:10160. | ||||||||||||
| UCSC | uc001vni.3. human. uc001vnj.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 10160. | ||||||||||||
| GeneCards | GC13P098795. | ||||||||||||
| HGNC | HGNC:3591. FARP1. | ||||||||||||
| HPA | HPA000760. | ||||||||||||
| MIM | 602654. gene. | ||||||||||||
| neXtProt | NX_Q9Y4F1. | ||||||||||||
| PharmGKB | PA28004. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG282099. | ||||||||||||
| HOGENOM | HOG000007957. | ||||||||||||
| HOVERGEN | HBG081521. | ||||||||||||
| OrthoDB | EOG4J3WG7. | ||||||||||||
| PhylomeDB | Q9Y4F1. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9Y4F1. | ||||||||||||
| Bgee | Q9Y4F1. | ||||||||||||
| CleanEx | HS_FARP1. | ||||||||||||
| Genevestigator | Q9Y4F1. | ||||||||||||
| GermOnline | ENSG00000152767. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.20.80.10. 1 hit. 1.20.900.10. 1 hit. 2.30.29.30. 3 hits. | ||||||||||||
| InterPro | IPR019749. Band_41_domain. IPR019750. Band_41_fam. IPR000219. DH-domain. IPR000798. Ez/rad/moesin_like. IPR014847. FERM-adjacent. IPR014352. FERM/acyl-CoA-bd_prot_3-hlx. IPR019748. FERM_central. IPR019747. FERM_CS. IPR000299. FERM_domain. IPR018979. FERM_N. IPR018980. FERM_PH-like_C. IPR011993. PH_like_dom. IPR001849. Pleckstrin_homology. [Graphical view] | ||||||||||||
| Pfam | PF08736. FA. 1 hit. PF09380. FERM_C. 1 hit. PF00373. FERM_M. 1 hit. PF09379. FERM_N. 1 hit. PF00169. PH. 2 hits. PF00621. RhoGEF. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00935. BAND41. PR00661. ERMFAMILY. | ||||||||||||
| SMART | SM00295. B41. 1 hit. SM00233. PH. 2 hits. SM00325. RhoGEF. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF48065. DH-domain. 1 hit. SSF47031. FERM_3-hlx. 1 hit. | ||||||||||||
| PROSITE | PS00741. DH_1. False negative. PS50010. DH_2. 1 hit. PS00660. FERM_1. 1 hit. PS00661. FERM_2. False negative. PS50057. FERM_3. 1 hit. PS50003. PH_DOMAIN. 2 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | FARP1. human. | ||||||||||||
| GenomeRNAi | 10160. | ||||||||||||
| NextBio | 38464. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | FARP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y4F1 Secondary accession number(s): Q5JVI9, Q6IQ29 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 13 Human chromosome 13: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
