Q9Y4E8 (UBP15_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 130.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ubiquitin carboxyl-terminal hydrolase 15 EC=3.4.19.12 Alternative name(s): Deubiquitinating enzyme 15 Ubiquitin thioesterase 15 Ubiquitin-specific-processing protease 15 Unph-2 Unph4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 981 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Hydrolase that removes conjugated ubiquitin from target proteins and regulates various pathways such as the TGF-beta receptor signaling and NF-kappa-B pathways. Acts as a key regulator of TGF-beta receptor signaling pathway, but the precise mechanism is still unclear: according to a report, acts by promoting deubiquitination of monoubiquitinated R-SMADs (SMAD1, SMAD2 and/or SMAD3), thereby alleviating inhibition of R-SMADs and promoting activation of TGF-beta target genes (Ref.22). According to another reports, regulates the TGF-beta receptor signaling pathway by mediating deubiquitination and stabilization of TGFBR1, leading to an enhanced TGF-beta signal (Ref.24). Able to mediate deubiquitination of monoubiquitinated substrates as well as 'Lys-48'-linked polyubiquitin chains, protecting them against proteasomal degradation. Acts as an associated component of COP9 signalosome complex (CSN) and regulates different pathways via this association: regulates NF-kappa-B by mediating deubiquitination of NFKBIA and deubiquitinates substrates bound to VCP. Protects APC and human papillomavirus type 16 protein E6 against degradation via the ubiquitin proteasome pathway. Ref.12 Ref.14 Ref.16 Ref.17 Ref.18 Ref.22 Ref.24 |
| Catalytic activity | Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal). Ref.10 Ref.12 Ref.22 Ref.24 |
| Subunit structure | A homodimer structure has been reported; however it is unclear whether the protein form a homodimer in vivo (Ref.27). Identified in a complex with the COP9 signalosome complex (CSN). Interacts with SMAD1, SMAD2 and SMAD3; the interaction is direct. Forms a complex with SMURF2 and SMAD7. Interacts with TGFBR1. Interacts with human papillomavirus type 16 protein E6. Ref.12 Ref.18 Ref.22 Ref.24 |
| Subcellular location | |
| Tissue specificity | Expressed in skeletal muscle, kidney, heart, placenta, liver, thymus, lung, and ovary, with little or no expression in other tissues. |
| Post-translational modification | Phosphorylated. Phosphorylation protects against ubiquitination and subsequent degradation by the proteasome. Ref.12 Ubiquitinated, leading to degradation by the proteasome. Ref.12 |
| Sequence similarities | Belongs to the peptidase C19 family. Contains 1 DUSP domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y4E8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y4E8-2) The sequence of this isoform differs from the canonical sequence as follows: 228-256: Missing. | ||||||
| Isoform 3 (identifier: Q9Y4E8-3) The sequence of this isoform differs from the canonical sequence as follows: 217-256: DGTWPRGPSTPKSPGASNFSTLPKISPSSLSNNYNNMNNR → QKNEDGTWPRGPSTP | ||||||
| Isoform 4 (identifier: Q9Y4E8-4) The sequence of this isoform differs from the canonical sequence as follows: 229-235: SPGASNF → KPLEQSC 236-981: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 981 | 980 | Ubiquitin carboxyl-terminal hydrolase 15 | PRO_0000080641 | |||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 7 – 118 | 112 | DUSP | ||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 298 | 1 | Nucleophile | ||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 891 | 1 | Proton acceptor By similarity | ||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 229 | 1 | Phosphoserine Ref.13 Ref.15 Ref.19 Ref.20 Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 242 | 1 | Phosphoserine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 961 | 1 | Phosphoserine Ref.15 Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 965 | 1 | Phosphoserine Ref.15 Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 217 – 256 | 40 | DGTWP…NMNNR → QKNEDGTWPRGPSTP in isoform 3. | VSP_005260 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 228 – 256 | 29 | Missing in isoform 2. | VSP_005261 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 229 – 235 | 7 | SPGASNF → KPLEQSC in isoform 4. | VSP_045165 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 236 – 981 | 746 | Missing in isoform 4. | VSP_045166 | |||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 298 | 1 | C → A: Loss of enzyme activity. Ref.18 Ref.22 Ref.24 | ||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 812 | 1 | C → A: Loss of activity towards polyubiquitin. Ref.12 Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 559 | 1 | T → A in AAG28973. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 747 | 1 | S → F in AAI25124. Ref.7 | ||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 968 | 1 | N → H in AAG28973. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 4 – 6 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 9 – 19 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 29 – 34 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 35 – 45 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 46 – 48 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 53 – 56 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 58 – 60 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 68 – 70 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 73 – 76 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 86 – 88 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 89 – 93 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 94 – 104 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 114 – 120 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 127 – 129 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 134 – 140 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 143 – 152 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 158 – 168 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 173 – 175 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 177 – 184 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 187 – 190 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 198 – 201 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 208 – 213 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of a new human deubiquitinating enzyme Unph4." Kim K.I., Nagase T., Chung C.H. Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Brain. |
| [2] | "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [4] | "A catalogue of genes in the human dermal papilla cells as identified by expressed sequence tags." Kim M.K., Kim Y.H., Seo J.M., Lee H.M., Chung H.J., Sohn M.Y., Hwang S.Y., Im S.U., Jung E.J., Lee J.H., Kim J.C. Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Hair follicle dermal papilla. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Placenta. |
| [6] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4). Tissue: Brain and Lung. |
| [8] | Bienvenut W.V., Matallanas D., Cooper W.N., Kolch W. Submitted (JUL-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-21; 475-482 AND 924-932, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, MASS SPECTROMETRY. Tissue: Mammary carcinoma. |
| [9] | "Cloning and identification of human Unph-2." Kimura Y., Saya H., Nakao M. Submitted (JUL-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 19-981 (ISOFORM 3). Tissue: Fetal brain. |
| [10] | "Identification, functional characterization, and chromosomal localization of USP15, a novel human ubiquitin-specific protease related to the UNP oncoprotein, and a systematic nomenclature for human ubiquitin-specific proteases." Baker R.T., Wang X.-W., Woollatt E., White J.A., Sutherland G.R. Genomics 59:264-274(1999) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION (ISOFORM 2), CATALYTIC ACTIVITY. |
| [11] | "Isolation and characterization of the mouse ubiquitin-specific protease Usp15." Angelats C., Wang X.-W., Jermiin L.S., Copeland N.G., Jenkins N.A., Baker R.T. Mamm. Genome 14:31-46(2003) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 1 AND 2). |
| [12] | "The zinc finger of the CSN-associated deubiquitinating enzyme USP15 is essential to rescue the E3 ligase Rbx1." Hetfeld B.K., Helfrich A., Kapelari B., Scheel H., Hofmann K., Guterman A., Glickman M., Schade R., Kloetzel P.M., Dubiel W. Curr. Biol. 15:1217-1221(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, MUTAGENESIS OF CYS-812, IDENTIFICATION IN A COMPLEX WITH THE COP9 SIGNALOSOME, PHOSPHORYLATION, UBIQUITINATION. |
| [13] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-229, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "CSN controls NF-kappaB by deubiquitinylation of IkappaBalpha." Schweitzer K., Bozko P.M., Dubiel W., Naumann M. EMBO J. 26:1532-1541(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [15] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-229; SER-961 AND SER-965, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [16] | "COP9 signalosome interacts ATP-dependently with p97/valosin-containing protein (VCP) and controls the ubiquitination status of proteins bound to p97/VCP." Cayli S., Klug J., Chapiro J., Frohlich S., Krasteva G., Orel L., Meinhardt A. J. Biol. Chem. 284:34944-34953(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [17] | "The COP9 signalosome mediates beta-catenin degradation by deneddylation and blocks adenomatous polyposis coli destruction via USP15." Huang X., Langelotz C., Hetfeld-Pechoc B.K., Schwenk W., Dubiel W. J. Mol. Biol. 391:691-702(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF CYS-812. |
| [18] | "The ubiquitin-specific peptidase USP15 regulates human papillomavirus type 16 E6 protein stability." Vos R.M., Altreuter J., White E.A., Howley P.M. J. Virol. 83:8885-8892(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF CYS-298, INTERACTION WITH HUMAN PAPILLOMAVIRUS TYPE 16 PROTEIN E6. |
| [19] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-229, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [20] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-229; SER-242; SER-961 AND SER-965, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [21] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [22] | "USP15 is a deubiquitylating enzyme for receptor-activated SMADs." Inui M., Manfrin A., Mamidi A., Martello G., Morsut L., Soligo S., Enzo E., Moro S., Polo S., Dupont S., Cordenonsi M., Piccolo S. Nat. Cell Biol. 13:1368-1375(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, INTERACTION WITH SMAD1; SMAD2 AND SMAD3, MUTAGENESIS OF CYS-298. |
| [23] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-229, MASS SPECTROMETRY. |
| [24] | "USP15 stabilizes TGF-beta receptor I and promotes oncogenesis through the activation of TGF-beta signaling in glioblastoma." Eichhorn P.J., Rodon L., Gonzalez-Junca A., Dirac A., Gili M., Martinez-Saez E., Aura C., Barba I., Peg V., Prat A., Cuartas I., Jimenez J., Garcia-Dorado D., Sahuquillo J., Bernards R., Baselga J., Seoane J. Nat. Med. 18:429-435(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH TGFBR1 AND SMAD7, MUTAGENESIS OF CYS-298. |
| [25] | "Solution structure of the human ubiquitin-specific protease 15 DUSP domain." de Jong R.N., Ab E., Diercks T., Truffault V., Danieels M., Kaptein R., Folkers G.E. J. Biol. Chem. 281:5026-5031(2006) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 1-120. |
| [26] | "Structure of the USP15 N-terminal domains: a beta-hairpin mediates close association between the DUSP and UBL domains." Harper S., Besong T.M., Emsley J., Scott D.J., Dreveny I. Biochemistry 50:7995-8004(2011) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.5 ANGSTROMS) OF 1-222. |
| [27] | "Structural variability of the ubiquitin specific protease DUSP-UBL double domains." Elliott P.R., Liu H., Pastok M.W., Grossmann G.J., Rigden D.J., Clague M.J., Urbe S., Barsukov I.L. FEBS Lett. 585:3385-3390(2011) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 1-223. |
| [28] | "Crystal structure of the human ubiquitin-specific protease 15 DUSP domain." Structural genomics consortium (SGC) Submitted (APR-2010) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 1-133. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF106069 mRNA. Translation: AAD52099.1. AB011101 mRNA. Translation: BAA25455.2. AF153604 mRNA. Translation: AAD41086.1. AK023703 mRNA. Translation: BAB14648.1. AK292337 mRNA. Translation: BAF85026.1. AC048342 Genomic DNA. No translation available. AC079035 Genomic DNA. No translation available. AC117370 Genomic DNA. No translation available. BC020688 mRNA. Translation: AAH20688.1. BC063454 mRNA. Translation: AAH63454.1. BC125123 mRNA. Translation: AAI25124.1. AF013990 mRNA. Translation: AAG28973.1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00000728. IPI00219504. IPI01015293. | ||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001239007.1. NM_001252078.1. NP_001239008.1. NM_001252079.1. NP_006304.1. NM_006313.2. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.434951. | ||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9Y4E8. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q9Y4E8. 32 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000258123. | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| MEROPS | C19.022. | ||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9Y4E8. | ||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 28381406. | ||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q9Y4E8. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q9Y4E8. | ||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 9958. | ||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000280377; ENSP00000280377; ENSG00000135655. ENST00000312635; ENSP00000309240; ENSG00000135655. ENST00000353364; ENSP00000258123; ENSG00000135655. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 9958. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:9958. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001srb.2. human. uc001src.2. human. | ||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 9958. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC12P062706. | ||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0010773. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:12613. USP15. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA006237. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 604731. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q9Y4E8. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA37239. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG5560. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000264375. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG000864. | ||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q9Y4E8. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K11835. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | RMDPLAK. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4DNF3R. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q9Y4E8. | ||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9Y4E8. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q9Y4E8. | ||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_USP15. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9Y4E8. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000135655. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR006615. Pept_C19_DUSP. IPR018200. Pept_C19ubi-hydrolase_C_CS. IPR001394. Peptidase_C19. IPR013792. RNA3'P_cycl/enolpyr_Trfase_a/b. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF06337. DUSP. 1 hit. PF00443. UCH. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00695. DUSP. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF55205. RNA3'_cycl/enolpyr_transf_A/B. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS51283. DUSP. 1 hit. PS00972. UCH_2_1. 1 hit. PS00973. UCH_2_2. 1 hit. PS50235. UCH_2_3. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | USP15. human. | ||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q9Y4E8. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 9958. | ||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 37576. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | UBP15_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y4E8 Secondary accession number(s): Q08AL5 Q9Y5B5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
