Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable E3 ubiquitin-protein ligase HECTD4

Gene

HECTD4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.By similarity

Catalytic activityi

S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei3964Glycyl thioester intermediatePROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

  • glucose homeostasis Source: UniProtKB
  • glucose metabolic process Source: UniProtKB
  • protein ubiquitination involved in ubiquitin-dependent protein catabolic process Source: GO_Central
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable E3 ubiquitin-protein ligase HECTD4 (EC:2.3.2.26)
Alternative name(s):
HECT domain-containing protein 4
HECT-type E3 ubiquitin transferase HECTD4
Gene namesi
Name:HECTD4
Synonyms:C12orf51, KIAA0614
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:26611. HECTD4.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei282 – 302HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi283450.

Polymorphism and mutation databases

DMDMi300669718.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003426811 – 3996Probable E3 ubiquitin-protein ligase HECTD4Add BLAST3996

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2080PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9Y4D8.
PeptideAtlasiQ9Y4D8.
PRIDEiQ9Y4D8.

PTM databases

iPTMnetiQ9Y4D8.
PhosphoSitePlusiQ9Y4D8.

Expressioni

Gene expression databases

BgeeiENSG00000173064.

Organism-specific databases

HPAiHPA041062.
HPA045473.

Interactioni

Protein-protein interaction databases

IntActiQ9Y4D8. 1 interactor.
MINTiMINT-3306664.
STRINGi9606.ENSP00000449784.

Structurei

3D structure databases

ProteinModelPortaliQ9Y4D8.
SMRiQ9Y4D8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini3627 – 3996HECTPROSITE-ProRule annotationAdd BLAST370

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi2867 – 2909Ser-richAdd BLAST43

Sequence similaritiesi

Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1426. Eukaryota.
COG5184. LUCA.
HOVERGENiHBG106580.
InParanoidiQ9Y4D8.
PhylomeDBiQ9Y4D8.

Family and domain databases

CDDicd00078. HECTc. 1 hit.
InterProiIPR000569. HECT_dom.
[Graphical view]
PfamiPF00632. HECT. 1 hit.
[Graphical view]
SMARTiSM00119. HECTc. 1 hit.
[Graphical view]
SUPFAMiSSF56204. SSF56204. 1 hit.
PROSITEiPS50237. HECT. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y4D8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPANHLPIGS TMSTVHLSSD GTYFYWIWSP ASLNEKTPKG HSVFMDIFEL
60 70 80 90 100
VVENGVFVAN PLQERTILMR KEGESAKSIN EMLLSRLSRY RASPSATLAA
110 120 130 140 150
LTGSTISNTL KEDQAANTSC GLPLKMLRKT PIYTCGTYLV MLVPPPGGSG
160 170 180 190 200
SSATRSLFGG TSGLSSLKRA CYDTVNNMLW TCSNDYIDQW CNPGNQAFHY
210 220 230 240 250
VCQRLGVSHI ITEPKEEAIT TNEVINQLLH HVGAMCIHQL NLLATNPNLP
260 270 280 290 300
ITSVLGKQHP IEAHHLSSIC DIMEKAMVNG DTCIIRCILV VFQVVFKFFF
310 320 330 340 350
SPQTERNRDI IRRSGLLLWQ LLMAPKDQIC PEIQKEVCLA ISSGLNILYP
360 370 380 390 400
GETEINNLLK LVLTEGERNS GLSQLRDVIL TNLAEQLQNN RFGSDEDDHY
410 420 430 440 450
RLNDELLHYI LKIVVRESCI LITKCQTVSK DDFQKLLSTV PAASSCLRYL
460 470 480 490 500
MAVQNHLLSN TILIKPDEND DSDSSLQGET LKVQELKVSI LALATQILTG
510 520 530 540 550
CDEVLEMLQQ VTTALINSDI ADREQRLKGL EQVTKATMLG HLLPVLLTSL
560 570 580 590 600
MHPNLQTLIM ADALMPQLVQ LVLYTSQTAL LLKTQCPVFA EVGCSPCGAP
610 620 630 640 650
DQKCRLFPDE RMLEEKEEPG FLTGLKIPAP WAAGKTVETV HPVRDNYKFK
660 670 680 690 700
ETVHIPGARC LYLRFDSRCS SQYDYDKLVI YAGPNTNSRK VAEYGGNTLG
710 720 730 740 750
YGSRSVLGTG WPKDLVKCIS PPSLNFKVEG DTVTFSFEMR SGREHNTPDK
760 770 780 790 800
AMWGFACTVR AQESSEDVSG GLPFLVDLAL GLSVLACSML RILYNGPEIT
810 820 830 840 850
KEEEACQELL RSKLLQRCQW QVEANGVISP ALTPSPSPLP LTIEEDREFT
860 870 880 890 900
YPSDVLVPPV GNYFDLPRIR LPPGIMIKLR EISGRARPQF RPSIKEVIQP
910 920 930 940 950
DVMEEMVVSC VIKHLNLVDA LQSLINFQYQ EEHAEEYDLL CKIMGETFKK
960 970 980 990 1000
LNAMERQLQS VAELEQKWQS EVDDAMQGKL ENNMPFFYDY HFNENKMKEL
1010 1020 1030 1040 1050
ELLCSMKEVS FDGNDLENMV LSLREKFLQE VNSLIQKPSH PLAKTKTLVK
1060 1070 1080 1090 1100
SLMNRAELLL HVTIAAQSGL TRSISGTPAE TPACKSASET KVISHAVRQP
1110 1120 1130 1140 1150
VFLRSMSAPS DLEMIGNEDL EFTRANQRRR HVTSHRSSSF TLLQSLAIED
1160 1170 1180 1190 1200
SRDKPTYSVL LGQLFAFIGT NPDQAVSSSS FLLAAQTRWR RGNTRKQALV
1210 1220 1230 1240 1250
HMRELLTAAV RVGGVTHLVG PVTMVLQGGP RIEELTCGGM VEQVQEAFGE
1260 1270 1280 1290 1300
TMTSVVSLCA RYPIACANSI GLLCTIPYTR SEEKCLVRSG LVQLMDRLCS
1310 1320 1330 1340 1350
LSNQTESSSS EKQTKKQKVA TMAWAAFQVL ANRCVEWEKE EGGSTEAVHS
1360 1370 1380 1390 1400
GLARQVSSLL TNHLARATEC CGNQAAGNDA LQDVLSLLND LSRSHIGKAI
1410 1420 1430 1440 1450
LSQPACVSKL LSLLLDQRPS PKLVLIILQL CRAALPLMSV EDCGNVELPP
1460 1470 1480 1490 1500
WSYSVPSLNS EQEDPSDPAS KIASLLLAKL ADYVVPGCQT VLSPTASEPD
1510 1520 1530 1540 1550
TTLTKTSPKN SLKGDKDPGE ESEAVDGKLS IFIHKREDQS SHEVLQPLLS
1560 1570 1580 1590 1600
SSEGRPFRLG TGANMEKVVK MDRDMTKGGC CEVITEEAAA ALRKATKWAQ
1610 1620 1630 1640 1650
SGLIVSIGPP VESINPETVS GLSTGDKKKT AQTSICRERN SELARTDPVR
1660 1670 1680 1690 1700
PFISGHVANS MAAEVIALLH SLLMAPESNA AQIWTTTAEK VLSRALMYIP
1710 1720 1730 1740 1750
QLGKYAESIL ENGSSSGRKL AKLQRIARQA VAALCALGGF KETIKIGSEV
1760 1770 1780 1790 1800
QVLGRGISGS IGVVASINEQ EGIATVRFPP IDCRKTSQAS DTLTIPLSRL
1810 1820 1830 1840 1850
CVPRSEALPL HKLSITEKVV QAVQSMLLPQ EGSLSIHTSL PATGDGSAPV
1860 1870 1880 1890 1900
MAVVRLLAEI RTRACLVMAQ LLEDSLFCEE FIQQCPAAVE VLNLVAQECS
1910 1920 1930 1940 1950
AGERLAVVEV QCERLRMLYR DCARPPPPPL QADRRQPKEI TWSPSRVFPP
1960 1970 1980 1990 2000
VRACMFSSHL TSVTFLADPS AGGGLPRGTF IYATSPLPVQ APSFYWEIEI
2010 2020 2030 2040 2050
VSYGDTDDDT GPIVSFGFTT EAEKRDGAWT NPVGTCLFHN NGRAVHYNGS
2060 2070 2080 2090 2100
SLLQWKSVRL DVTLSPGDVA GIGWERTEGT PPPPGQPAKG RVYFTYCGQR
2110 2120 2130 2140 2150
LSPYLEDVSG GMWPVVHIQK KNTKTRANFG SRPFAYAEGQ AHRNAADLCT
2160 2170 2180 2190 2200
DLAEEISANF EALPFAMASD SDNDAGTSIA SDPGTHGPPC RIAAVATAQQ
2210 2220 2230 2240 2250
QYDSDTSCHY KVELSYENFI TSGPDPHPPP IADDESDDDD DDDIPQEDHY
2260 2270 2280 2290 2300
ALLVKAWETK VFPTIRRRFR NEAERKSGLD QIKGALQLGM VDIARQTVEF
2310 2320 2330 2340 2350
LYEENGGIPR DLYLPTIEDI KDEANKFTID KVRKGLTVVT RSPDSNNVAS
2360 2370 2380 2390 2400
SAVGTALPKF AIRGMLKTFG LHGVVLDVDS VNELVQVETY LRSEGVLVRY
2410 2420 2430 2440 2450
WYPIDMLERP PAGYRRTATN GLVTLDNTNL QIHRELLRCE AALARLYCRM
2460 2470 2480 2490 2500
ALLNIFAPKL PHLFTRLFHI PAIRDITLEH LQLLSNQLLA PPLPDGTISS
2510 2520 2530 2540 2550
SSILLAQSLQ HCIHSQNCSA TDLFYQGNSQ TVREWLNVAI TRTLHQGEES
2560 2570 2580 2590 2600
LLELTKQICS FLQTAPEQFP SEEFPISESK VNMDVNFPGA AFVVVSCKES
2610 2620 2630 2640 2650
QSGFRKDSSL YKAPWARVLV YGLGHKVKRN GQLNLIEAAC YPRDASPANT
2660 2670 2680 2690 2700
GLAPPPTADQ YPSVVLSTDR VHIKLGVSPP PGAVLVLHSL PLEFPLAMAF
2710 2720 2730 2740 2750
AEQLLSWKSE DSEGKSEDEP DTIPTSVLLQ VVELLGNFLW TTDMAACVKE
2760 2770 2780 2790 2800
LVFHLLAELL RTVHTLEQRR HPAGLSSSIA LQLNPCLAML MALQSELHKL
2810 2820 2830 2840 2850
YDEETQNWVS GGACGGSGGA AAGDQGRFST YFHALMEGCL AVAEVTLPTN
2860 2870 2880 2890 2900
MSVTASGVTS ATAPNLSDSS SSSSSSPGQT PQSPSLLSKR KKVKMKREKA
2910 2920 2930 2940 2950
SSSGKRQSSR TVDSDPTVLS IGGSKPEDML WFHRALTLLI ILRHLTRKDP
2960 2970 2980 2990 3000
QGLGVTSDAI ADACQALVGP TAHSRLLVIS GIPTHLDEGV VRGAIRKACN
3010 3020 3030 3040 3050
AHGGVFKDEI YIPLQEEDTK KPKDKAEGGD GKVEPEKTLA FPGTDSMEVS
3060 3070 3080 3090 3100
TSSSLTPAMS ISASASTSQA SICSSQGISQ TVSDLSVDPL PAGLELPIPP
3110 3120 3130 3140 3150
GLLEPHAVSS QESLDISLCS TGSLGSLGSL GEPLDNAETA SVSDMGSMYT
3160 3170 3180 3190 3200
VTSLDNQPLA ARPIKGFAVV EIRSRAKIEK IRASLFNNND LIGLSSLDGE
3210 3220 3230 3240 3250
DELMEMSTEE ILTVSVVNQS LFDTQGSPGL EDYFNDKSIK GEKLVPGARE
3260 3270 3280 3290 3300
VLTEIFKSCA HSEQTLSLTP AKPIRVSDIY LSKEQINSQT PGNLLHLFFT
3310 3320 3330 3340 3350
NVRPPKKVLE DQLTQILRKY GVPKPKFDKS KYSKAGKEQH PVKVVSTKRP
3360 3370 3380 3390 3400
ITKPPAKDKA VLNSVSRTAL SEKKPTVKPK SPEKSKPDEK DPEKSPTKKQ
3410 3420 3430 3440 3450
EVPEEKYLTL EGFHKFVIDR ARQDIRSVWR AILSCGYDLH FERCACIDVR
3460 3470 3480 3490 3500
HAQKASRKWT LEMDVALVQY INQLCRHLAI TPARLHPHEV YLDPADAADP
3510 3520 3530 3540 3550
RVACLLNVPI ESLRLRFALL QSLNTTLETF FLPLVELRQT PMYTHSIAAL
3560 3570 3580 3590 3600
LKEAKGLIFY DTKVTVMNRV LNATVQRTAD HAAPEITLDP LEIVGGEIRA
3610 3620 3630 3640 3650
SENSYFCQAA RQLASVPSSQ LCVKLASGGD PTYAFNIRFT GEEVHGTSGS
3660 3670 3680 3690 3700
FRHFLWQVCK ELQSSSLSLL LLCPSSAVNK NKGKYILTPS PITYGEEQLL
3710 3720 3730 3740 3750
HFLGQLLGIA IRADVPLPLD LLPSFWKTLV GEPLDPEQDL QEADILTYNY
3760 3770 3780 3790 3800
VKKFESINDE TELEALCAEI ASQHLATESP DSPNKPCCRF TYLTMTGEEV
3810 3820 3830 3840 3850
ELCSRGRHIL VAWENKDIYA AAIRSLRLRE LQNVECVTAV RAGLGSIIPL
3860 3870 3880 3890 3900
QLLTMLSPLE MELRTCGLPY INLEFLKAHT MYQVGLMETD QHIEFFWGAL
3910 3920 3930 3940 3950
EMFTQEELCK FIKFACNQER IPFTCPCKDG GPDTAHVPPY PMKIAPPDGT
3960 3970 3980 3990
AGSPDSRYIR VETCMFMIKL PQYSSLEIML EKLRCAIHYR EDPLSG
Length:3,996
Mass (Da):439,344
Last modified:July 13, 2010 - v5
Checksum:i5F091CA1EDD207D4
GO
Isoform 2 (identifier: Q9Y4D8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2382-2386: NELVQ → SEQPF
     2387-3996: Missing.

Note: No experimental confirmation available.
Show »
Length:2,386
Mass (Da):262,203
Checksum:i2F062A3F80AC9BF5
GO
Isoform 3 (identifier: Q9Y4D8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     717-726: Missing.
     896-899: EVIQ → YVAV
     900-3996: Missing.

Note: No experimental confirmation available.
Show »
Length:889
Mass (Da):98,752
Checksum:iE1CAC6DAF98832A6
GO
Isoform 4 (identifier: Q9Y4D8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     483-484: Missing.
     717-726: Missing.

Note: No experimental confirmation available.
Show »
Length:3,984
Mass (Da):438,030
Checksum:iECFB26B97AE232D9
GO
Isoform 5 (identifier: Q9Y4D8-5) [UniParc]FASTAAdd to basket
Also known as: POTAGE

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGSSAAAAAA...TLQVCQVVPM
     169-169: R → ILASSLVYNISDGQFTSRADLIDAAGSSLGRGALVPGLG
     717-726: Missing.
     896-899: EVIQ → YVAV
     900-3996: Missing.

Show »
Length:1,321
Mass (Da):145,076
Checksum:i794DC0E73FB9A093
GO

Sequence cautioni

The sequence AAF36539 differs from that shown. Contaminating sequence. Sequence of unknown origin in the N-terminal part.Curated
The sequence AAH65706 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH65706 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI01483 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA31589 differs from that shown. Contaminating sequence. Sequence of unknown origin in the N-terminal part.Curated
The sequence BAC03671 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti170A → G in AAH65706 (PubMed:15489334).Curated1
Sequence conflicti681Y → C in BAC03671 (PubMed:14702039).Curated1
Sequence conflicti801K → E in AAH65706 (PubMed:15489334).Curated1
Sequence conflicti2019T → I in AK054654 (PubMed:14702039).Curated1
Sequence conflicti2702E → G in AAF36539 (Ref. 7) Curated1
Sequence conflicti2867S → T in AAF36539 (Ref. 7) Curated1
Sequence conflicti2896 – 2897KR → NA in AAF36539 (Ref. 7) Curated2
Sequence conflicti2902S → C in AAF36539 (Ref. 7) Curated1
Sequence conflicti3153S → P in AAF36539 (Ref. 7) Curated1
Sequence conflicti3182R → Q in AAF36539 (Ref. 7) Curated1
Sequence conflicti3191L → F in AAF36539 (Ref. 7) Curated1
Sequence conflicti3419 – 3420DR → YQ in AAF36539 (Ref. 7) Curated2
Sequence conflicti3665S → A in AAF36539 (Ref. 7) Curated1
Sequence conflicti3723P → T in AAH06270 (PubMed:15489334).Curated1
Sequence conflicti3726W → R in AAH06270 (PubMed:15489334).Curated1
Sequence conflicti3732 – 3733EP → DA in AAF36539 (Ref. 7) Curated2
Sequence conflicti3798E → R in AAF36539 (Ref. 7) Curated1
Sequence conflicti3830E → A in AAF36539 (Ref. 7) Curated1
Sequence conflicti3985C → G in AAF36539 (Ref. 7) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0474651M → MGSSAAAAAAAAAAADSAQW LSVKEETIFLHDGLIRVTDL AELPSEILGAPEAADTDLEI LTFETKNPSELAERLRSVCG NQSNAYARLLEYRLNALRGL WNAQRQLALEEQHERESSGD EETLALLKRQGLLQQPEQAP FTSRMGLLLVFPLIQSQSRT DPSLCNITAEVLLNCLRDCQ PLSLTKEPADCLNGIETLLC SWLEETSDTGRHIPHKQKEN AAAALVALACARGSLKTFVH TVHLLQKQTDLGSLPVADVL YRLLLLEGGPGSPSCLLGGK HIVSWGYEDMLPAPDSNTGS SSENKDADLGRCLTADGLYL YTTNSVGRGVSKLGSGLHGT LRGFVYCRNEELEPGWVAFG SGSLLHRPVSFDNKPHSLFQ VIDQNTLQVCQVVPM in isoform 5. 1 Publication1
Alternative sequenceiVSP_047466169R → ILASSLVYNISDGQFTSRAD LIDAAGSSLGRGALVPGLG in isoform 5. 1 Publication1
Alternative sequenceiVSP_039451483 – 484Missing in isoform 4. 1 Publication2
Alternative sequenceiVSP_039452717 – 726Missing in isoform 3, isoform 4 and isoform 5. 3 Publications10
Alternative sequenceiVSP_039453896 – 899EVIQ → YVAV in isoform 3 and isoform 5. 3 Publications4
Alternative sequenceiVSP_039454900 – 3996Missing in isoform 3 and isoform 5. 3 PublicationsAdd BLAST3097
Alternative sequenceiVSP_0345292382 – 2386NELVQ → SEQPF in isoform 2. 1 Publication5
Alternative sequenceiVSP_0345302387 – 3996Missing in isoform 2. 1 PublicationAdd BLAST1610

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB777655 mRNA. Translation: BAM76724.1.
AC073575 Genomic DNA. No translation available.
AC004031 Genomic DNA. No translation available.
AC004217 Genomic DNA. No translation available.
BC006270 mRNA. Translation: AAH06270.2.
BC021144 mRNA. Translation: AAH21144.1.
BC065706 mRNA. Translation: AAH65706.1. Sequence problems.
BC101482 mRNA. Translation: AAI01483.1. Different initiation.
AK054654 mRNA. No translation available.
AK091473 mRNA. Translation: BAC03671.1. Different initiation.
AB014514 mRNA. Translation: BAA31589.3. Sequence problems.
AF174498 mRNA. Translation: AAF36539.1. Sequence problems.
AL117469 mRNA. Translation: CAB55944.1.
PIRiT00390.
UniGeneiHs.530943.

Genome annotation databases

EnsembliENST00000430131; ENSP00000404379; ENSG00000173064.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB777655 mRNA. Translation: BAM76724.1.
AC073575 Genomic DNA. No translation available.
AC004031 Genomic DNA. No translation available.
AC004217 Genomic DNA. No translation available.
BC006270 mRNA. Translation: AAH06270.2.
BC021144 mRNA. Translation: AAH21144.1.
BC065706 mRNA. Translation: AAH65706.1. Sequence problems.
BC101482 mRNA. Translation: AAI01483.1. Different initiation.
AK054654 mRNA. No translation available.
AK091473 mRNA. Translation: BAC03671.1. Different initiation.
AB014514 mRNA. Translation: BAA31589.3. Sequence problems.
AF174498 mRNA. Translation: AAF36539.1. Sequence problems.
AL117469 mRNA. Translation: CAB55944.1.
PIRiT00390.
UniGeneiHs.530943.

3D structure databases

ProteinModelPortaliQ9Y4D8.
SMRiQ9Y4D8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9Y4D8. 1 interactor.
MINTiMINT-3306664.
STRINGi9606.ENSP00000449784.

PTM databases

iPTMnetiQ9Y4D8.
PhosphoSitePlusiQ9Y4D8.

Polymorphism and mutation databases

DMDMi300669718.

Proteomic databases

PaxDbiQ9Y4D8.
PeptideAtlasiQ9Y4D8.
PRIDEiQ9Y4D8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000430131; ENSP00000404379; ENSG00000173064.

Organism-specific databases

DisGeNETi283450.
GeneCardsiHECTD4.
HGNCiHGNC:26611. HECTD4.
HPAiHPA041062.
HPA045473.
neXtProtiNX_Q9Y4D8.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1426. Eukaryota.
COG5184. LUCA.
HOVERGENiHBG106580.
InParanoidiQ9Y4D8.
PhylomeDBiQ9Y4D8.

Enzyme and pathway databases

UniPathwayiUPA00143.

Miscellaneous databases

PROiQ9Y4D8.

Gene expression databases

BgeeiENSG00000173064.

Family and domain databases

CDDicd00078. HECTc. 1 hit.
InterProiIPR000569. HECT_dom.
[Graphical view]
PfamiPF00632. HECT. 1 hit.
[Graphical view]
SMARTiSM00119. HECTc. 1 hit.
[Graphical view]
SUPFAMiSSF56204. SSF56204. 1 hit.
PROSITEiPS50237. HECT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiHECD4_HUMAN
AccessioniPrimary (citable) accession number: Q9Y4D8
Secondary accession number(s): L8B0P6
, Q3MJD5, Q6P0A0, Q7L530, Q8NB70, Q8WU73, Q96NT9, Q9NZS4, Q9UFT6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 2008
Last sequence update: July 13, 2010
Last modified: November 30, 2016
This is version 119 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.