Q9Y4C0 (NRX3A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 132.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Neurexin-3 Alternative name(s): Neurexin III-alpha Neurexin-3-alpha | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1643 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Neuronal cell surface protein that may be involved in cell recognition and cell adhesion. May mediate intracellular signaling. |
| Subunit structure | The laminin G-like domain 2 binds to NXPH1. Specific isoforms bind to alpha-dystroglycan. The cytoplasmic C-terminal region binds to CASK By similarity. |
| Subcellular location | Membrane; Single-pass type I membrane protein Potential. |
| Tissue specificity | Expressed in the blood vessel walls (at protein level). Highly expressed in brain, lung, and pancreas; a lower level of expression is detectable in heart, placenta, liver, and kidney, whereas no expression can be observed in skeletal muscle. Isoform 4a is heart-specific. Ref.1 Ref.7 |
| Sequence similarities | Belongs to the neurexin family. Contains 3 EGF-like domains. Contains 6 laminin G-like domains. |
| Sequence caution | The sequence BAA34463.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] Note: A number of isoforms alpha-type and beta-type are produced by alternative promoter usage. Beta-type isoforms differ from alpha-type isoforms in their N-terminus. Additional isoforms produced by alternative splicing seem to exist. | ||||||
| Isoform 1a (identifier: Q9Y4C0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 3a (identifier: Q9Y4C0-3) The sequence of this isoform differs from the canonical sequence as follows: 1-373: Missing. 1334-1542: Missing. | ||||||
| Note: Produced by alternative splicing. | ||||||
| Isoform 4a (identifier: Q9Y4C0-4) The sequence of this isoform differs from the canonical sequence as follows: 237-242: Missing. 252-252: Q → QGRSK 750-759: DCIRINCNSS → G 1205-1205: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK 1335-1373: TGGELVIPLL...PPTFRPLLTI → GRSARSSNAA...IIFISCVVHS 1374-1643: Missing. | ||||||
| Note: Produced by alternative splicing. | ||||||
| Isoform 1b (identifier: Q9HDB5-1) The sequence of this isoform can be found in the external entry Q9HDB5. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Isoform 2b (identifier: Q9HDB5-2) The sequence of this isoform can be found in the external entry Q9HDB5. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Note: Produced by alternative splicing. | ||||||
| Isoform 3b (identifier: Q9HDB5-3) The sequence of this isoform can be found in the external entry Q9HDB5. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Note: Produced by alternative splicing. No experimental confirmation available. | ||||||
| Isoform 4b (identifier: Q9HDB5-4) The sequence of this isoform can be found in the external entry Q9HDB5. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Note: Produced by alternative splicing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 27 | 27 | By similarity | ||||||||
| Chain | 28 – 1643 | 1616 | Neurexin-3 | PRO_0000019499 | |||||||
Regions | |||||||||||
| Topological domain | 28 – 1568 | 1541 | Extracellular Potential | ||||||||
| Transmembrane | 1569 – 1589 | 21 | Helical; Potential | ||||||||
| Topological domain | 1590 – 1643 | 54 | Cytoplasmic Potential | ||||||||
| Domain | 28 – 202 | 175 | Laminin G-like 1 | ||||||||
| Domain | 198 – 235 | 38 | EGF-like 1 | ||||||||
| Domain | 258 – 440 | 183 | Laminin G-like 2 | ||||||||
| Domain | 447 – 639 | 193 | Laminin G-like 3 | ||||||||
| Domain | 643 – 680 | 38 | EGF-like 2 | ||||||||
| Domain | 685 – 857 | 173 | Laminin G-like 4 | ||||||||
| Domain | 871 – 1046 | 176 | Laminin G-like 5 | ||||||||
| Domain | 1049 – 1086 | 38 | EGF-like 3 | ||||||||
| Domain | 1090 – 1260 | 171 | Laminin G-like 6 | ||||||||
Sites | |||||||||||
| Metal binding | 304 | 1 | Calcium By similarity | ||||||||
| Metal binding | 321 | 1 | Calcium; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 374 | 1 | Calcium; via carbonyl oxygen By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 58 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 105 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 757 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1189 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1257 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1301 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 202 ↔ 213 | By similarity | |||||||||
| Disulfide bond | 207 ↔ 222 | By similarity | |||||||||
| Disulfide bond | 224 ↔ 234 | By similarity | |||||||||
| Disulfide bond | 404 ↔ 440 | By similarity | |||||||||
| Disulfide bond | 610 ↔ 639 | By similarity | |||||||||
| Disulfide bond | 647 ↔ 658 | By similarity | |||||||||
| Disulfide bond | 652 ↔ 667 | By similarity | |||||||||
| Disulfide bond | 669 ↔ 679 | By similarity | |||||||||
| Disulfide bond | 1018 ↔ 1046 | By similarity | |||||||||
| Disulfide bond | 1053 ↔ 1064 | By similarity | |||||||||
| Disulfide bond | 1058 ↔ 1073 | By similarity | |||||||||
| Disulfide bond | 1075 ↔ 1085 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 373 | 373 | Missing in isoform 3a. | VSP_036463 | |||||||
| Alternative sequence | 237 – 242 | 6 | Missing in isoform 4a. | VSP_041699 | |||||||
| Alternative sequence | 252 | 1 | Q → QGRSK in isoform 4a. | VSP_041700 | |||||||
| Alternative sequence | 750 – 759 | 10 | DCIRINCNSS → G in isoform 4a. | VSP_041701 | |||||||
| Alternative sequence | 1205 | 1 | T → TGNTDNERFQMVKQKIPFKY NRPVEEWLQEK in isoform 4a. | VSP_041702 | |||||||
| Alternative sequence | 1334 – 1542 | 209 | Missing in isoform 3a. | VSP_036464 | |||||||
| Alternative sequence | 1335 – 1373 | 39 | TGGEL…PLLTI → GRSARSSNAARSLRAALTWT WRLTYTFTPIIFISCVVHS in isoform 4a. | VSP_041703 | |||||||
| Alternative sequence | 1374 – 1643 | 270 | Missing in isoform 4a. | VSP_041704 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 1043 | 1 | E → K in BAA34463. Ref.3 | ||||||||
| Sequence conflict | 1043 | 1 | E → K in AAI52458. Ref.6 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of heart-specific splicing of human neurexin 3 mRNA (NRXN3)." Occhi G., Rampazzo A., Beffagna G., Antonio Danieli G. Biochem. Biophys. Res. Commun. 298:151-155(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4A), TISSUE SPECIFICITY. Tissue: Heart. |
| [2] | "Analysis of the human neurexin genes: alternative splicing and the generation of protein diversity." Rowen L., Young J., Birditt B., Kaur A., Madan A., Philipps D.L., Qin S., Minx P., Wilson R.K., Hood L., Graveley B.R. Genomics 79:587-597(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING. |
| [3] | "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3A). Tissue: Brain. |
| [4] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3A). |
| [7] | "The synaptic proteins neurexins and neuroligins are widely expressed in the vascular system and contribute to its functions." Bottos A., Destro E., Rissone A., Graziano S., Cordara G., Assenzio B., Cera M.R., Mascia L., Bussolino F., Arese M. Proc. Natl. Acad. Sci. U.S.A. 106:20782-20787(2009) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ316284 mRNA. Translation: CAC87720.2. AF099810 Genomic DNA. Translation: AAC68909.1. AF123462 Genomic DNA. Translation: AAD13621.1. AB018286 mRNA. Translation: BAA34463.2. Different initiation. AC008056 Genomic DNA. Translation: AAF09143.1. AC012099 Genomic DNA. Translation: AAF15058.1. AC009396 Genomic DNA. Translation: AAF21147.1. AC008045 Genomic DNA. Translation: AAF28465.1. AC011440 Genomic DNA. Translation: AAF61277.1. AC026888 Genomic DNA. Translation: AAF87841.1. CH471061 Genomic DNA. Translation: EAW81316.1. BC152457 mRNA. Translation: AAI52458.1. |
| IPI | IPI00414249. IPI00854729. IPI01025492. |
| RefSeq | NP_004787.2. NM_004796.5. |
| UniGene | Hs.368307. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1C4R based on UniProtKB Q63373. |
| ProteinModelPortal | Q9Y4C0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9Y4C0. 1 interaction. |
PTM databases | |
| PhosphoSite | Q9Y4C0. |
Polymorphism databases | |
| DMDM | 224471902. |
Proteomic databases | |
| PaxDb | Q9Y4C0. |
| PRIDE | Q9Y4C0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000335750; ENSP00000338349; ENSG00000021645. ENST00000554719; ENSP00000451648; ENSG00000021645. ENST00000554738; ENSP00000450683; ENSG00000021645. |
| GeneID | 9369. |
| KEGG | hsa:9369. |
| UCSC | uc001xun.3. human. |
Organism-specific databases | |
| CTD | 9369. |
| GeneCards | GC14P078710. |
| HGNC | HGNC:8010. NRXN3. |
| HPA | HPA002727. |
| MIM | 600567. gene. |
| neXtProt | NX_Q9Y4C0. |
| PharmGKB | PA31788. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG302266. |
| HOVERGEN | HBG052670. |
| KO | K07377. |
Gene expression databases | |
| ArrayExpress | Q9Y4C0. |
| Bgee | Q9Y4C0. |
| CleanEx | HS_NRXN3. |
| Genevestigator | Q9Y4C0. |
| GermOnline | ENSG00000021645. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.120.200. 6 hits. |
| InterPro | IPR008985. ConA-like_lec_gl_sf. IPR013320. ConA-like_subgrp. IPR000742. EG-like_dom. IPR000152. EGF-type_Asp/Asn_hydroxyl_site. IPR001791. Laminin_G. IPR003585. Neurexin-like. IPR027149. NRXN3-alpha. [Graphical view] |
| PANTHER | PTHR10127:SF405. PTHR10127:SF405. 1 hit. |
| Pfam | PF02210. Laminin_G_2. 6 hits. [Graphical view] |
| SMART | SM00294. 4.1m. 1 hit. SM00181. EGF. 3 hits. SM00282. LamG. 6 hits. [Graphical view] |
| SUPFAM | SSF49899. ConA_like_lec_gl. 6 hits. |
| PROSITE | PS00010. ASX_HYDROXYL. 1 hit. PS00022. EGF_1. False negative. PS01186. EGF_2. False negative. PS50026. EGF_3. 3 hits. PS50025. LAM_G_DOMAIN. 6 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | NRXN3. human. |
| GenomeRNAi | 9369. |
| NextBio | 35088. |
| SOURCE | Search... |
Entry information
| Entry name | NRX3A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y4C0 Secondary accession number(s): A6NGR4 Q9Y486 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
