Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y4C0

- NRX3A_HUMAN

UniProt

Q9Y4C0 - NRX3A_HUMAN

Protein

Neurexin-3

Gene

NRXN3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 146 (01 Oct 2014)
      Sequence version 4 (03 Mar 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Neuronal cell surface protein that may be involved in cell recognition and cell adhesion. May mediate intracellular signaling.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi304 – 3041CalciumBy similarity
    Metal bindingi321 – 3211Calcium; via carbonyl oxygenBy similarity
    Metal bindingi374 – 3741Calcium; via carbonyl oxygenBy similarity

    GO - Molecular functioni

    1. calcium channel regulator activity Source: Ensembl
    2. cell adhesion molecule binding Source: BHF-UCL
    3. metal ion binding Source: UniProtKB-KW
    4. neuroligin family protein binding Source: BHF-UCL
    5. receptor activity Source: ProtInc

    GO - Biological processi

    1. adult behavior Source: BHF-UCL
    2. axon guidance Source: ProtInc
    3. learning Source: BHF-UCL
    4. neuron cell-cell adhesion Source: BHF-UCL
    5. neurotransmitter secretion Source: Ensembl
    6. positive regulation of synapse assembly Source: InterPro
    7. positive regulation of synapse maturation Source: InterPro
    8. social behavior Source: BHF-UCL
    9. synapse assembly Source: Ensembl
    10. vocalization behavior Source: BHF-UCL

    Keywords - Biological processi

    Cell adhesion

    Keywords - Ligandi

    Calcium, Metal-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Neurexin-3
    Alternative name(s):
    Neurexin III-alpha
    Neurexin-3-alpha
    Gene namesi
    Name:NRXN3
    Synonyms:C14orf60, KIAA0743
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 14

    Organism-specific databases

    HGNCiHGNC:8010. NRXN3.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31788.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2727By similarityAdd
    BLAST
    Chaini28 – 16431616Neurexin-3PRO_0000019499Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi58 – 581N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi105 – 1051N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi202 ↔ 213By similarity
    Disulfide bondi207 ↔ 222By similarity
    Disulfide bondi224 ↔ 234By similarity
    Disulfide bondi404 ↔ 440By similarity
    Disulfide bondi610 ↔ 639By similarity
    Disulfide bondi647 ↔ 658By similarity
    Disulfide bondi652 ↔ 667By similarity
    Disulfide bondi669 ↔ 679By similarity
    Glycosylationi757 – 7571N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi1018 ↔ 1046By similarity
    Disulfide bondi1053 ↔ 1064By similarity
    Disulfide bondi1058 ↔ 1073By similarity
    Disulfide bondi1075 ↔ 1085By similarity
    Glycosylationi1189 – 11891N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1257 – 12571N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1301 – 13011N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ9Y4C0.
    PRIDEiQ9Y4C0.

    PTM databases

    PhosphoSiteiQ9Y4C0.

    Expressioni

    Tissue specificityi

    Expressed in the blood vessel walls (at protein level). Highly expressed in brain, lung, and pancreas; a lower level of expression is detectable in heart, placenta, liver, and kidney, whereas no expression can be observed in skeletal muscle. Isoform 4a is heart-specific.2 Publications

    Gene expression databases

    ArrayExpressiQ9Y4C0.
    BgeeiQ9Y4C0.
    CleanExiHS_NRXN3.
    GenevestigatoriQ9Y4C0.

    Organism-specific databases

    HPAiHPA002727.

    Interactioni

    Subunit structurei

    The laminin G-like domain 2 binds to NXPH1. Specific isoforms bind to alpha-dystroglycan. The cytoplasmic C-terminal region binds to CASK By similarity.By similarity

    Protein-protein interaction databases

    BioGridi114770. 5 interactions.
    IntActiQ9Y4C0. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Y4C0.
    SMRiQ9Y4C0. Positions 38-1266.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini28 – 15681541ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1590 – 164354CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei1569 – 158921HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini28 – 202175Laminin G-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini198 – 23538EGF-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini258 – 440183Laminin G-like 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini447 – 639193Laminin G-like 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini643 – 68038EGF-like 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini685 – 857173Laminin G-like 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini871 – 1046176Laminin G-like 5PROSITE-ProRule annotationAdd
    BLAST
    Domaini1049 – 108638EGF-like 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini1090 – 1260171Laminin G-like 6PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the neurexin family.Curated
    Contains 3 EGF-like domains.PROSITE-ProRule annotation
    Contains 6 laminin G-like domains.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG302266.
    HOVERGENiHBG052670.
    KOiK07377.
    OMAiRDIKCGD.
    OrthoDBiEOG7XWPMM.
    PhylomeDBiQ9Y4C0.
    TreeFamiTF321302.

    Family and domain databases

    Gene3Di2.60.120.200. 6 hits.
    InterProiIPR008985. ConA-like_lec_gl_sf.
    IPR013320. ConA-like_subgrp.
    IPR000742. EG-like_dom.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR001791. Laminin_G.
    IPR003585. Neurexin-like.
    IPR027158. NRXN3.
    IPR027789. Syndecan/Neurexin_dom.
    [Graphical view]
    PANTHERiPTHR10127:SF405. PTHR10127:SF405. 1 hit.
    PfamiPF02210. Laminin_G_2. 6 hits.
    PF01034. Syndecan. 1 hit.
    [Graphical view]
    SMARTiSM00294. 4.1m. 1 hit.
    SM00181. EGF. 3 hits.
    SM00282. LamG. 6 hits.
    [Graphical view]
    SUPFAMiSSF49899. SSF49899. 6 hits.
    PROSITEiPS00010. ASX_HYDROXYL. 1 hit.
    PS50026. EGF_3. 3 hits.
    PS50025. LAM_G_DOMAIN. 6 hits.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 7 isoformsi produced by alternative promoter usage and alternative splicing. Align

    Note: A number of isoforms alpha-type and beta-type are produced by alternative promoter usage. Beta-type isoforms differ from alpha-type isoforms in their N-terminus. Additional isoforms produced by alternative splicing seem to exist.1 Publication

    Isoform 1a (identifier: Q9Y4C0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSSTLHSVFF TLKVSILLGS LLGLCLGLEF MGLPNQWARY LRWDASTRSD     50
    LSFQFKTNVS TGLLLYLDDG GVCDFLCLSL VDGRVQLRFS MDCAETAVLS 100
    NKQVNDSSWH FLMVSRDRLR TVLMLDGEGQ SGELQPQRPY MDVVSDLFLG 150
    GVPTDIRPSA LTLDGVQAMP GFKGLILDLK YGNSEPRLLG SRGVQMDAEG 200
    PCGERPCENG GICFLLDGHP TCDCSTTGYG GKLCSEDVSQ DPGLSHLMMS 250
    EQAREENVAT FRGSEYLCYD LSQNPIQSSS DEITLSFKTW QRNGLILHTG 300
    KSADYVNLAL KDGAVSLVIN LGSGAFEAIV EPVNGKFNDN AWHDVKVTRN 350
    LRQVTISVDG ILTTTGYTQE DYTMLGSDDF FYVGGSPSTA DLPGSPVSNN 400
    FMGCLKEVVY KNNDIRLELS RLARIADTKM KIYGEVVFKC ENVATLDPIN 450
    FETPEAYISL PKWNTKRMGS ISFDFRTTEP NGLILFTHGK PQERKDARSQ 500
    KNTKVDFFAV ELLDGNLYLL LDMGSGTIKV KATQKKANDG EWYHVDIQRD 550
    GRSGTISVNS RRTPFTASGE SEILDLEGDM YLGGLPENRA GLILPTELWT 600
    AMLNYGYVGC IRDLFIDGRS KNIRQLAEMQ NAAGVKSSCS RMSAKQCDSY 650
    PCKNNAVCKD GWNRFICDCT GTGYWGRTCE REASILSYDG SMYMKIIMPM 700
    VMHTEAEDVS FRFMSQRAYG LLVATTSRDS ADTLRLELDG GRVKLMVNLD 750
    CIRINCNSSK GPETLYAGQK LNDNEWHTVR VVRRGKSLKL TVDDDVAEGT 800
    MVGDHTRLEF HNIETGIMTE KRYISVVPSS FIGHLQSLMF NGLLYIDLCK 850
    NGDIDYCELK ARFGLRNIIA DPVTFKTKSS YLSLATLQAY TSMHLFFQFK 900
    TTSPDGFILF NSGDGNDFIA VELVKGYIHY VFDLGNGPNV IKGNSDRPLN 950
    DNQWHNVVIT RDNSNTHSLK VDTKVVTQVI NGAKNLDLKG DLYMAGLAQG 1000
    MYSNLPKLVA SRDGFQGCLA SVDLNGRLPD LINDALHRSG QIERGCEGPS 1050
    TTCQEDSCAN QGVCMQQWEG FTCDCSMTSY SGNQCNDPGA TYIFGKSGGL 1100
    ILYTWPANDR PSTRSDRLAV GFSTTVKDGI LVRIDSAPGL GDFLQLHIEQ 1150
    GKIGVVFNIG TVDISIKEER TPVNDGKYHV VRFTRNGGNA TLQVDNWPVN 1200
    EHYPTGRQLT IFNTQAQIAI GGKDKGRLFQ GQLSGLYYDG LKVLNMAAEN 1250
    NPNIKINGSV RLVGEVPSIL GTTQTTSMPP EMSTTVMETT TTMATTTTRK 1300
    NRSTASIQPT SDDLVSSAEC SSDDEDFVEC EPSTTGGELV IPLLVEDPLA 1350
    TPPIATRAPS ITLPPTFRPL LTIIETTKDS LSMTSEAGLP CLSDQGSDGC 1400
    DDDGLVISGY GSGETFDSNL PPTDDEDFYT TFSLVTDKSL STSIFEGGYK 1450
    AHAPKWESKD FRPNKVSETS RTTTTSLSPE LIRFTASSSS GMVPKLPAGK 1500
    MNNRDLKPQP DIVLLPLPTA YELDSTKLKS PLITSPMFRN VPTANPTEPG 1550
    IRRVPGASEV IRESSSTTGM VVGIVAAAAL CILILLYAMY KYRNRDEGSY 1600
    QVDETRNYIS NSAQSNGTLM KEKQQSSKSG HKKQKNKDRE YYV 1643
    Length:1,643
    Mass (Da):180,599
    Last modified:March 3, 2009 - v4
    Checksum:iE7360348E263C6EC
    GO
    Isoform 3a (identifier: Q9Y4C0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-373: Missing.
         1334-1542: Missing.

    Note: Produced by alternative splicing.

    Show »
    Length:1,061
    Mass (Da):117,317
    Checksum:i5BB0495CAE63A1AD
    GO
    Isoform 4a (identifier: Q9Y4C0-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         237-242: Missing.
         252-252: Q → QGRSK
         750-759: DCIRINCNSS → G
         1205-1205: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK
         1335-1373: TGGELVIPLL...PPTFRPLLTI → GRSARSSNAA...IIFISCVVHS
         1374-1643: Missing.

    Note: Produced by alternative splicing.

    Show »
    Length:1,392
    Mass (Da):153,885
    Checksum:i32D1B3F77340C23D
    GO
    Isoform 1b (identifier: Q9HDB5-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q9HDB5.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
    Length:637
    Mass (Da):69,305
    GO
    Isoform 2b (identifier: Q9HDB5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q9HDB5.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: Produced by alternative splicing.

    Length:432
    Mass (Da):47,270
    GO
    Isoform 3b (identifier: Q9HDB5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q9HDB5.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: Produced by alternative splicing. No experimental confirmation available.

    Length:396
    Mass (Da):43,766
    GO
    Isoform 4b (identifier: Q9HDB5-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q9HDB5.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: Produced by alternative splicing.

    Length:459
    Mass (Da):50,705
    GO

    Sequence cautioni

    The sequence BAA34463.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1043 – 10431E → K in BAA34463. (PubMed:9872452)Curated
    Sequence conflicti1043 – 10431E → K in AAI52458. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 373373Missing in isoform 3a. 2 PublicationsVSP_036463Add
    BLAST
    Alternative sequencei237 – 2426Missing in isoform 4a. 1 PublicationVSP_041699
    Alternative sequencei252 – 2521Q → QGRSK in isoform 4a. 1 PublicationVSP_041700
    Alternative sequencei750 – 75910DCIRINCNSS → G in isoform 4a. 1 PublicationVSP_041701
    Alternative sequencei1205 – 12051T → TGNTDNERFQMVKQKIPFKY NRPVEEWLQEK in isoform 4a. 1 PublicationVSP_041702
    Alternative sequencei1334 – 1542209Missing in isoform 3a. 2 PublicationsVSP_036464Add
    BLAST
    Alternative sequencei1335 – 137339TGGEL…PLLTI → GRSARSSNAARSLRAALTWT WRLTYTFTPIIFISCVVHS in isoform 4a. 1 PublicationVSP_041703Add
    BLAST
    Alternative sequencei1374 – 1643270Missing in isoform 4a. 1 PublicationVSP_041704Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ316284 mRNA. Translation: CAC87720.2.
    AF099810 Genomic DNA. Translation: AAC68909.1.
    AF123462 Genomic DNA. Translation: AAD13621.1.
    AB018286 mRNA. Translation: BAA34463.2. Different initiation.
    AC008056 Genomic DNA. Translation: AAF09143.1.
    AC012099 Genomic DNA. Translation: AAF15058.1.
    AC009396 Genomic DNA. Translation: AAF21147.1.
    AC008045 Genomic DNA. Translation: AAF28465.1.
    AC011440 Genomic DNA. Translation: AAF61277.1.
    AC026888 Genomic DNA. Translation: AAF87841.1.
    CH471061 Genomic DNA. Translation: EAW81316.1.
    BC152457 mRNA. Translation: AAI52458.1.
    CCDSiCCDS9870.1. [Q9Y4C0-3]
    RefSeqiNP_004787.2. NM_004796.5. [Q9Y4C0-3]
    UniGeneiHs.368307.

    Genome annotation databases

    EnsembliENST00000335750; ENSP00000338349; ENSG00000021645. [Q9Y4C0-3]
    ENST00000554719; ENSP00000451648; ENSG00000021645. [Q9Y4C0-3]
    ENST00000554738; ENSP00000450683; ENSG00000021645. [Q9Y4C0-4]
    GeneIDi9369.
    KEGGihsa:9369.
    UCSCiuc001xun.4. human. [Q9Y4C0-3]
    uc010asv.1. human. [Q9Y4C0-4]

    Polymorphism databases

    DMDMi224471902.

    Keywords - Coding sequence diversityi

    Alternative promoter usage, Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ316284 mRNA. Translation: CAC87720.2 .
    AF099810 Genomic DNA. Translation: AAC68909.1 .
    AF123462 Genomic DNA. Translation: AAD13621.1 .
    AB018286 mRNA. Translation: BAA34463.2 . Different initiation.
    AC008056 Genomic DNA. Translation: AAF09143.1 .
    AC012099 Genomic DNA. Translation: AAF15058.1 .
    AC009396 Genomic DNA. Translation: AAF21147.1 .
    AC008045 Genomic DNA. Translation: AAF28465.1 .
    AC011440 Genomic DNA. Translation: AAF61277.1 .
    AC026888 Genomic DNA. Translation: AAF87841.1 .
    CH471061 Genomic DNA. Translation: EAW81316.1 .
    BC152457 mRNA. Translation: AAI52458.1 .
    CCDSi CCDS9870.1. [Q9Y4C0-3 ]
    RefSeqi NP_004787.2. NM_004796.5. [Q9Y4C0-3 ]
    UniGenei Hs.368307.

    3D structure databases

    ProteinModelPortali Q9Y4C0.
    SMRi Q9Y4C0. Positions 38-1266.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114770. 5 interactions.
    IntActi Q9Y4C0. 1 interaction.

    PTM databases

    PhosphoSitei Q9Y4C0.

    Polymorphism databases

    DMDMi 224471902.

    Proteomic databases

    PaxDbi Q9Y4C0.
    PRIDEi Q9Y4C0.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000335750 ; ENSP00000338349 ; ENSG00000021645 . [Q9Y4C0-3 ]
    ENST00000554719 ; ENSP00000451648 ; ENSG00000021645 . [Q9Y4C0-3 ]
    ENST00000554738 ; ENSP00000450683 ; ENSG00000021645 . [Q9Y4C0-4 ]
    GeneIDi 9369.
    KEGGi hsa:9369.
    UCSCi uc001xun.4. human. [Q9Y4C0-3 ]
    uc010asv.1. human. [Q9Y4C0-4 ]

    Organism-specific databases

    CTDi 9369.
    GeneCardsi GC14P078710.
    HGNCi HGNC:8010. NRXN3.
    HPAi HPA002727.
    MIMi 600567. gene.
    neXtProti NX_Q9Y4C0.
    PharmGKBi PA31788.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG302266.
    HOVERGENi HBG052670.
    KOi K07377.
    OMAi RDIKCGD.
    OrthoDBi EOG7XWPMM.
    PhylomeDBi Q9Y4C0.
    TreeFami TF321302.

    Miscellaneous databases

    ChiTaRSi NRXN3. human.
    GenomeRNAii 9369.
    NextBioi 35088.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9Y4C0.
    Bgeei Q9Y4C0.
    CleanExi HS_NRXN3.
    Genevestigatori Q9Y4C0.

    Family and domain databases

    Gene3Di 2.60.120.200. 6 hits.
    InterProi IPR008985. ConA-like_lec_gl_sf.
    IPR013320. ConA-like_subgrp.
    IPR000742. EG-like_dom.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR001791. Laminin_G.
    IPR003585. Neurexin-like.
    IPR027158. NRXN3.
    IPR027789. Syndecan/Neurexin_dom.
    [Graphical view ]
    PANTHERi PTHR10127:SF405. PTHR10127:SF405. 1 hit.
    Pfami PF02210. Laminin_G_2. 6 hits.
    PF01034. Syndecan. 1 hit.
    [Graphical view ]
    SMARTi SM00294. 4.1m. 1 hit.
    SM00181. EGF. 3 hits.
    SM00282. LamG. 6 hits.
    [Graphical view ]
    SUPFAMi SSF49899. SSF49899. 6 hits.
    PROSITEi PS00010. ASX_HYDROXYL. 1 hit.
    PS50026. EGF_3. 3 hits.
    PS50025. LAM_G_DOMAIN. 6 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification and characterization of heart-specific splicing of human neurexin 3 mRNA (NRXN3)."
      Occhi G., Rampazzo A., Beffagna G., Antonio Danieli G.
      Biochem. Biophys. Res. Commun. 298:151-155(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4A), TISSUE SPECIFICITY.
      Tissue: Heart.
    2. "Analysis of the human neurexin genes: alternative splicing and the generation of protein diversity."
      Rowen L., Young J., Birditt B., Kaur A., Madan A., Philipps D.L., Qin S., Minx P., Wilson R.K., Hood L., Graveley B.R.
      Genomics 79:587-597(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING.
    3. "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3A).
      Tissue: Brain.
    4. "The DNA sequence and analysis of human chromosome 14."
      Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
      , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
      Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3A).
    7. "The synaptic proteins neurexins and neuroligins are widely expressed in the vascular system and contribute to its functions."
      Bottos A., Destro E., Rissone A., Graziano S., Cordara G., Assenzio B., Cera M.R., Mascia L., Bussolino F., Arese M.
      Proc. Natl. Acad. Sci. U.S.A. 106:20782-20787(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiNRX3A_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y4C0
    Secondary accession number(s): A6NGR4
    , A7MD34, O95378, Q8IUE3, Q9NS47, Q9P1V3, Q9P1V6, Q9UIE2, Q9UIE3, Q9ULA5, Q9Y486
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 16, 2001
    Last sequence update: March 3, 2009
    Last modified: October 1, 2014
    This is version 146 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3