SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Y4C0

- NRX3A_HUMAN

UniProt

Q9Y4C0 - NRX3A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Neurexin-3
Gene
NRXN3, C14orf60, KIAA0743
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Neuronal cell surface protein that may be involved in cell recognition and cell adhesion. May mediate intracellular signaling.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi304 – 3041Calcium By similarity
Metal bindingi321 – 3211Calcium; via carbonyl oxygen By similarity
Metal bindingi374 – 3741Calcium; via carbonyl oxygen By similarity

GO - Molecular functioni

  1. calcium channel regulator activity Source: Ensembl
  2. cell adhesion molecule binding Source: BHF-UCL
  3. metal ion binding Source: UniProtKB-KW
  4. neuroligin family protein binding Source: BHF-UCL
  5. receptor activity Source: ProtInc

GO - Biological processi

  1. adult behavior Source: BHF-UCL
  2. axon guidance Source: ProtInc
  3. learning Source: BHF-UCL
  4. neuron cell-cell adhesion Source: BHF-UCL
  5. neurotransmitter secretion Source: Ensembl
  6. positive regulation of synapse assembly Source: InterPro
  7. positive regulation of synapse maturation Source: InterPro
  8. social behavior Source: BHF-UCL
  9. synapse assembly Source: Ensembl
  10. vocalization behavior Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Neurexin-3
Alternative name(s):
Neurexin III-alpha
Neurexin-3-alpha
Gene namesi
Name:NRXN3
Synonyms:C14orf60, KIAA0743
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:8010. NRXN3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini28 – 15681541Extracellular Reviewed prediction
Add
BLAST
Transmembranei1569 – 158921Helical; Reviewed prediction
Add
BLAST
Topological domaini1590 – 164354Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31788.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2727 By similarity
Add
BLAST
Chaini28 – 16431616Neurexin-3
PRO_0000019499Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi58 – 581N-linked (GlcNAc...) Reviewed prediction
Glycosylationi105 – 1051N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi202 ↔ 213 By similarity
Disulfide bondi207 ↔ 222 By similarity
Disulfide bondi224 ↔ 234 By similarity
Disulfide bondi404 ↔ 440 By similarity
Disulfide bondi610 ↔ 639 By similarity
Disulfide bondi647 ↔ 658 By similarity
Disulfide bondi652 ↔ 667 By similarity
Disulfide bondi669 ↔ 679 By similarity
Glycosylationi757 – 7571N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi1018 ↔ 1046 By similarity
Disulfide bondi1053 ↔ 1064 By similarity
Disulfide bondi1058 ↔ 1073 By similarity
Disulfide bondi1075 ↔ 1085 By similarity
Glycosylationi1189 – 11891N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1257 – 12571N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1301 – 13011N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9Y4C0.
PRIDEiQ9Y4C0.

PTM databases

PhosphoSiteiQ9Y4C0.

Expressioni

Tissue specificityi

Expressed in the blood vessel walls (at protein level). Highly expressed in brain, lung, and pancreas; a lower level of expression is detectable in heart, placenta, liver, and kidney, whereas no expression can be observed in skeletal muscle. Isoform 4a is heart-specific.2 Publications

Gene expression databases

ArrayExpressiQ9Y4C0.
BgeeiQ9Y4C0.
CleanExiHS_NRXN3.
GenevestigatoriQ9Y4C0.

Organism-specific databases

HPAiHPA002727.

Interactioni

Subunit structurei

The laminin G-like domain 2 binds to NXPH1. Specific isoforms bind to alpha-dystroglycan. The cytoplasmic C-terminal region binds to CASK By similarity.

Protein-protein interaction databases

BioGridi114770. 5 interactions.
IntActiQ9Y4C0. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ9Y4C0.
SMRiQ9Y4C0. Positions 38-1266.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini28 – 202175Laminin G-like 1
Add
BLAST
Domaini198 – 23538EGF-like 1
Add
BLAST
Domaini258 – 440183Laminin G-like 2
Add
BLAST
Domaini447 – 639193Laminin G-like 3
Add
BLAST
Domaini643 – 68038EGF-like 2
Add
BLAST
Domaini685 – 857173Laminin G-like 4
Add
BLAST
Domaini871 – 1046176Laminin G-like 5
Add
BLAST
Domaini1049 – 108638EGF-like 3
Add
BLAST
Domaini1090 – 1260171Laminin G-like 6
Add
BLAST

Sequence similaritiesi

Belongs to the neurexin family.
Contains 3 EGF-like domains.

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG302266.
HOVERGENiHBG052670.
KOiK07377.
OMAiRDIKCGD.
OrthoDBiEOG7XWPMM.
PhylomeDBiQ9Y4C0.
TreeFamiTF321302.

Family and domain databases

Gene3Di2.60.120.200. 6 hits.
InterProiIPR008985. ConA-like_lec_gl_sf.
IPR013320. ConA-like_subgrp.
IPR000742. EG-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR001791. Laminin_G.
IPR003585. Neurexin-like.
IPR027158. NRXN3.
IPR027789. Syndecan/Neurexin_dom.
[Graphical view]
PANTHERiPTHR10127:SF405. PTHR10127:SF405. 1 hit.
PfamiPF02210. Laminin_G_2. 6 hits.
PF01034. Syndecan. 1 hit.
[Graphical view]
SMARTiSM00294. 4.1m. 1 hit.
SM00181. EGF. 3 hits.
SM00282. LamG. 6 hits.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 6 hits.
PROSITEiPS00010. ASX_HYDROXYL. 1 hit.
PS50026. EGF_3. 3 hits.
PS50025. LAM_G_DOMAIN. 6 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative promoter usage and alternative splicing. Align

Note: A number of isoforms alpha-type and beta-type are produced by alternative promoter usage. Beta-type isoforms differ from alpha-type isoforms in their N-terminus. Additional isoforms produced by alternative splicing seem to exist.

Isoform 1a (identifier: Q9Y4C0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSSTLHSVFF TLKVSILLGS LLGLCLGLEF MGLPNQWARY LRWDASTRSD     50
LSFQFKTNVS TGLLLYLDDG GVCDFLCLSL VDGRVQLRFS MDCAETAVLS 100
NKQVNDSSWH FLMVSRDRLR TVLMLDGEGQ SGELQPQRPY MDVVSDLFLG 150
GVPTDIRPSA LTLDGVQAMP GFKGLILDLK YGNSEPRLLG SRGVQMDAEG 200
PCGERPCENG GICFLLDGHP TCDCSTTGYG GKLCSEDVSQ DPGLSHLMMS 250
EQAREENVAT FRGSEYLCYD LSQNPIQSSS DEITLSFKTW QRNGLILHTG 300
KSADYVNLAL KDGAVSLVIN LGSGAFEAIV EPVNGKFNDN AWHDVKVTRN 350
LRQVTISVDG ILTTTGYTQE DYTMLGSDDF FYVGGSPSTA DLPGSPVSNN 400
FMGCLKEVVY KNNDIRLELS RLARIADTKM KIYGEVVFKC ENVATLDPIN 450
FETPEAYISL PKWNTKRMGS ISFDFRTTEP NGLILFTHGK PQERKDARSQ 500
KNTKVDFFAV ELLDGNLYLL LDMGSGTIKV KATQKKANDG EWYHVDIQRD 550
GRSGTISVNS RRTPFTASGE SEILDLEGDM YLGGLPENRA GLILPTELWT 600
AMLNYGYVGC IRDLFIDGRS KNIRQLAEMQ NAAGVKSSCS RMSAKQCDSY 650
PCKNNAVCKD GWNRFICDCT GTGYWGRTCE REASILSYDG SMYMKIIMPM 700
VMHTEAEDVS FRFMSQRAYG LLVATTSRDS ADTLRLELDG GRVKLMVNLD 750
CIRINCNSSK GPETLYAGQK LNDNEWHTVR VVRRGKSLKL TVDDDVAEGT 800
MVGDHTRLEF HNIETGIMTE KRYISVVPSS FIGHLQSLMF NGLLYIDLCK 850
NGDIDYCELK ARFGLRNIIA DPVTFKTKSS YLSLATLQAY TSMHLFFQFK 900
TTSPDGFILF NSGDGNDFIA VELVKGYIHY VFDLGNGPNV IKGNSDRPLN 950
DNQWHNVVIT RDNSNTHSLK VDTKVVTQVI NGAKNLDLKG DLYMAGLAQG 1000
MYSNLPKLVA SRDGFQGCLA SVDLNGRLPD LINDALHRSG QIERGCEGPS 1050
TTCQEDSCAN QGVCMQQWEG FTCDCSMTSY SGNQCNDPGA TYIFGKSGGL 1100
ILYTWPANDR PSTRSDRLAV GFSTTVKDGI LVRIDSAPGL GDFLQLHIEQ 1150
GKIGVVFNIG TVDISIKEER TPVNDGKYHV VRFTRNGGNA TLQVDNWPVN 1200
EHYPTGRQLT IFNTQAQIAI GGKDKGRLFQ GQLSGLYYDG LKVLNMAAEN 1250
NPNIKINGSV RLVGEVPSIL GTTQTTSMPP EMSTTVMETT TTMATTTTRK 1300
NRSTASIQPT SDDLVSSAEC SSDDEDFVEC EPSTTGGELV IPLLVEDPLA 1350
TPPIATRAPS ITLPPTFRPL LTIIETTKDS LSMTSEAGLP CLSDQGSDGC 1400
DDDGLVISGY GSGETFDSNL PPTDDEDFYT TFSLVTDKSL STSIFEGGYK 1450
AHAPKWESKD FRPNKVSETS RTTTTSLSPE LIRFTASSSS GMVPKLPAGK 1500
MNNRDLKPQP DIVLLPLPTA YELDSTKLKS PLITSPMFRN VPTANPTEPG 1550
IRRVPGASEV IRESSSTTGM VVGIVAAAAL CILILLYAMY KYRNRDEGSY 1600
QVDETRNYIS NSAQSNGTLM KEKQQSSKSG HKKQKNKDRE YYV 1643
Length:1,643
Mass (Da):180,599
Last modified:March 3, 2009 - v4
Checksum:iE7360348E263C6EC
GO
Isoform 3a (identifier: Q9Y4C0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-373: Missing.
     1334-1542: Missing.

Note: Produced by alternative splicing.

Show »
Length:1,061
Mass (Da):117,317
Checksum:i5BB0495CAE63A1AD
GO
Isoform 4a (identifier: Q9Y4C0-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-242: Missing.
     252-252: Q → QGRSK
     750-759: DCIRINCNSS → G
     1205-1205: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK
     1335-1373: TGGELVIPLL...PPTFRPLLTI → GRSARSSNAA...IIFISCVVHS
     1374-1643: Missing.

Note: Produced by alternative splicing.

Show »
Length:1,392
Mass (Da):153,885
Checksum:i32D1B3F77340C23D
GO
Isoform 1b (identifier: Q9HDB5-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q9HDB5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:637
Mass (Da):69,305
GO
Isoform 2b (identifier: Q9HDB5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q9HDB5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Note: Produced by alternative splicing.

Length:432
Mass (Da):47,270
GO
Isoform 3b (identifier: Q9HDB5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q9HDB5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Note: Produced by alternative splicing. No experimental confirmation available.

Length:396
Mass (Da):43,766
GO
Isoform 4b (identifier: Q9HDB5-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q9HDB5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Note: Produced by alternative splicing.

Length:459
Mass (Da):50,705
GO

Sequence cautioni

The sequence BAA34463.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 373373Missing in isoform 3a.
VSP_036463Add
BLAST
Alternative sequencei237 – 2426Missing in isoform 4a.
VSP_041699
Alternative sequencei252 – 2521Q → QGRSK in isoform 4a.
VSP_041700
Alternative sequencei750 – 75910DCIRINCNSS → G in isoform 4a.
VSP_041701
Alternative sequencei1205 – 12051T → TGNTDNERFQMVKQKIPFKY NRPVEEWLQEK in isoform 4a.
VSP_041702
Alternative sequencei1334 – 1542209Missing in isoform 3a.
VSP_036464Add
BLAST
Alternative sequencei1335 – 137339TGGEL…PLLTI → GRSARSSNAARSLRAALTWT WRLTYTFTPIIFISCVVHS in isoform 4a.
VSP_041703Add
BLAST
Alternative sequencei1374 – 1643270Missing in isoform 4a.
VSP_041704Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1043 – 10431E → K in BAA34463. 1 Publication
Sequence conflicti1043 – 10431E → K in AAI52458. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ316284 mRNA. Translation: CAC87720.2.
AF099810 Genomic DNA. Translation: AAC68909.1.
AF123462 Genomic DNA. Translation: AAD13621.1.
AB018286 mRNA. Translation: BAA34463.2. Different initiation.
AC008056 Genomic DNA. Translation: AAF09143.1.
AC012099 Genomic DNA. Translation: AAF15058.1.
AC009396 Genomic DNA. Translation: AAF21147.1.
AC008045 Genomic DNA. Translation: AAF28465.1.
AC011440 Genomic DNA. Translation: AAF61277.1.
AC026888 Genomic DNA. Translation: AAF87841.1.
CH471061 Genomic DNA. Translation: EAW81316.1.
BC152457 mRNA. Translation: AAI52458.1.
CCDSiCCDS9870.1. [Q9Y4C0-3]
RefSeqiNP_004787.2. NM_004796.5. [Q9Y4C0-3]
UniGeneiHs.368307.

Genome annotation databases

EnsembliENST00000335750; ENSP00000338349; ENSG00000021645. [Q9Y4C0-3]
ENST00000554719; ENSP00000451648; ENSG00000021645. [Q9Y4C0-3]
ENST00000554738; ENSP00000450683; ENSG00000021645. [Q9Y4C0-4]
GeneIDi9369.
KEGGihsa:9369.
UCSCiuc001xun.4. human. [Q9Y4C0-3]
uc010asv.1. human. [Q9Y4C0-4]

Polymorphism databases

DMDMi224471902.

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ316284 mRNA. Translation: CAC87720.2 .
AF099810 Genomic DNA. Translation: AAC68909.1 .
AF123462 Genomic DNA. Translation: AAD13621.1 .
AB018286 mRNA. Translation: BAA34463.2 . Different initiation.
AC008056 Genomic DNA. Translation: AAF09143.1 .
AC012099 Genomic DNA. Translation: AAF15058.1 .
AC009396 Genomic DNA. Translation: AAF21147.1 .
AC008045 Genomic DNA. Translation: AAF28465.1 .
AC011440 Genomic DNA. Translation: AAF61277.1 .
AC026888 Genomic DNA. Translation: AAF87841.1 .
CH471061 Genomic DNA. Translation: EAW81316.1 .
BC152457 mRNA. Translation: AAI52458.1 .
CCDSi CCDS9870.1. [Q9Y4C0-3 ]
RefSeqi NP_004787.2. NM_004796.5. [Q9Y4C0-3 ]
UniGenei Hs.368307.

3D structure databases

ProteinModelPortali Q9Y4C0.
SMRi Q9Y4C0. Positions 38-1266.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114770. 5 interactions.
IntActi Q9Y4C0. 1 interaction.

PTM databases

PhosphoSitei Q9Y4C0.

Polymorphism databases

DMDMi 224471902.

Proteomic databases

PaxDbi Q9Y4C0.
PRIDEi Q9Y4C0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000335750 ; ENSP00000338349 ; ENSG00000021645 . [Q9Y4C0-3 ]
ENST00000554719 ; ENSP00000451648 ; ENSG00000021645 . [Q9Y4C0-3 ]
ENST00000554738 ; ENSP00000450683 ; ENSG00000021645 . [Q9Y4C0-4 ]
GeneIDi 9369.
KEGGi hsa:9369.
UCSCi uc001xun.4. human. [Q9Y4C0-3 ]
uc010asv.1. human. [Q9Y4C0-4 ]

Organism-specific databases

CTDi 9369.
GeneCardsi GC14P078710.
HGNCi HGNC:8010. NRXN3.
HPAi HPA002727.
MIMi 600567. gene.
neXtProti NX_Q9Y4C0.
PharmGKBi PA31788.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG302266.
HOVERGENi HBG052670.
KOi K07377.
OMAi RDIKCGD.
OrthoDBi EOG7XWPMM.
PhylomeDBi Q9Y4C0.
TreeFami TF321302.

Miscellaneous databases

ChiTaRSi NRXN3. human.
GenomeRNAii 9369.
NextBioi 35088.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9Y4C0.
Bgeei Q9Y4C0.
CleanExi HS_NRXN3.
Genevestigatori Q9Y4C0.

Family and domain databases

Gene3Di 2.60.120.200. 6 hits.
InterProi IPR008985. ConA-like_lec_gl_sf.
IPR013320. ConA-like_subgrp.
IPR000742. EG-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR001791. Laminin_G.
IPR003585. Neurexin-like.
IPR027158. NRXN3.
IPR027789. Syndecan/Neurexin_dom.
[Graphical view ]
PANTHERi PTHR10127:SF405. PTHR10127:SF405. 1 hit.
Pfami PF02210. Laminin_G_2. 6 hits.
PF01034. Syndecan. 1 hit.
[Graphical view ]
SMARTi SM00294. 4.1m. 1 hit.
SM00181. EGF. 3 hits.
SM00282. LamG. 6 hits.
[Graphical view ]
SUPFAMi SSF49899. SSF49899. 6 hits.
PROSITEi PS00010. ASX_HYDROXYL. 1 hit.
PS50026. EGF_3. 3 hits.
PS50025. LAM_G_DOMAIN. 6 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of heart-specific splicing of human neurexin 3 mRNA (NRXN3)."
    Occhi G., Rampazzo A., Beffagna G., Antonio Danieli G.
    Biochem. Biophys. Res. Commun. 298:151-155(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4A), TISSUE SPECIFICITY.
    Tissue: Heart.
  2. "Analysis of the human neurexin genes: alternative splicing and the generation of protein diversity."
    Rowen L., Young J., Birditt B., Kaur A., Madan A., Philipps D.L., Qin S., Minx P., Wilson R.K., Hood L., Graveley B.R.
    Genomics 79:587-597(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING.
  3. "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3A).
    Tissue: Brain.
  4. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3A).
  7. "The synaptic proteins neurexins and neuroligins are widely expressed in the vascular system and contribute to its functions."
    Bottos A., Destro E., Rissone A., Graziano S., Cordara G., Assenzio B., Cera M.R., Mascia L., Bussolino F., Arese M.
    Proc. Natl. Acad. Sci. U.S.A. 106:20782-20787(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiNRX3A_HUMAN
AccessioniPrimary (citable) accession number: Q9Y4C0
Secondary accession number(s): A6NGR4
, A7MD34, O95378, Q8IUE3, Q9NS47, Q9P1V3, Q9P1V6, Q9UIE2, Q9UIE3, Q9ULA5, Q9Y486
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: March 3, 2009
Last modified: July 9, 2014
This is version 145 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi