Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Y4C0 (NRX3A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 145. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Neurexin-3
Alternative name(s):
Neurexin III-alpha
Neurexin-3-alpha
Gene names
Name:NRXN3
Synonyms:C14orf60, KIAA0743
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1643 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Neuronal cell surface protein that may be involved in cell recognition and cell adhesion. May mediate intracellular signaling.

Subunit structure

The laminin G-like domain 2 binds to NXPH1. Specific isoforms bind to alpha-dystroglycan. The cytoplasmic C-terminal region binds to CASK By similarity.

Subcellular location

Membrane; Single-pass type I membrane protein Potential.

Tissue specificity

Expressed in the blood vessel walls (at protein level). Highly expressed in brain, lung, and pancreas; a lower level of expression is detectable in heart, placenta, liver, and kidney, whereas no expression can be observed in skeletal muscle. Isoform 4a is heart-specific. Ref.1 Ref.7

Sequence similarities

Belongs to the neurexin family.

Contains 3 EGF-like domains.

Contains 6 laminin G-like domains.

Sequence caution

The sequence BAA34463.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Ontologies

Keywords
   Biological processCell adhesion
   Cellular componentMembrane
   Coding sequence diversityAlternative promoter usage
Alternative splicing
   DomainEGF-like domain
Repeat
Signal
Transmembrane
Transmembrane helix
   LigandCalcium
Metal-binding
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processadult behavior

Inferred from genetic interaction PubMed 22209245. Source: BHF-UCL

axon guidance

Traceable author statement PubMed 1621094. Source: ProtInc

learning

Inferred from genetic interaction PubMed 22209245. Source: BHF-UCL

neuron cell-cell adhesion

Traceable author statement PubMed 18923512. Source: BHF-UCL

neurotransmitter secretion

Inferred from electronic annotation. Source: Ensembl

positive regulation of synapse assembly

Inferred from electronic annotation. Source: InterPro

positive regulation of synapse maturation

Inferred from electronic annotation. Source: InterPro

social behavior

Inferred from genetic interaction PubMed 22209245. Source: BHF-UCL

synapse assembly

Inferred from electronic annotation. Source: Ensembl

vocalization behavior

Inferred from genetic interaction PubMed 22209245. Source: BHF-UCL

   Cellular_componentintegral component of plasma membrane

Traceable author statement PubMed 1621094. Source: ProtInc

   Molecular_functioncalcium channel regulator activity

Inferred from electronic annotation. Source: Ensembl

cell adhesion molecule binding

Traceable author statement PubMed 18923512. Source: BHF-UCL

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

neuroligin family protein binding

Traceable author statement PubMed 18923512. Source: BHF-UCL

receptor activity

Traceable author statement PubMed 1621094. Source: ProtInc

Complete GO annotation...

Alternative products

This entry describes 7 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select]

Note: A number of isoforms alpha-type and beta-type are produced by alternative promoter usage. Beta-type isoforms differ from alpha-type isoforms in their N-terminus. Additional isoforms produced by alternative splicing seem to exist.
Isoform 1a (identifier: Q9Y4C0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 3a (identifier: Q9Y4C0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-373: Missing.
     1334-1542: Missing.
Note: Produced by alternative splicing.
Isoform 4a (identifier: Q9Y4C0-4)

The sequence of this isoform differs from the canonical sequence as follows:
     237-242: Missing.
     252-252: Q → QGRSK
     750-759: DCIRINCNSS → G
     1205-1205: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK
     1335-1373: TGGELVIPLL...PPTFRPLLTI → GRSARSSNAA...IIFISCVVHS
     1374-1643: Missing.
Note: Produced by alternative splicing.
Isoform 1b (identifier: Q9HDB5-1)

The sequence of this isoform can be found in the external entry Q9HDB5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Isoform 2b (identifier: Q9HDB5-2)

The sequence of this isoform can be found in the external entry Q9HDB5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative splicing.
Isoform 3b (identifier: Q9HDB5-3)

The sequence of this isoform can be found in the external entry Q9HDB5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative splicing. No experimental confirmation available.
Isoform 4b (identifier: Q9HDB5-4)

The sequence of this isoform can be found in the external entry Q9HDB5.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative splicing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2727 By similarity
Chain28 – 16431616Neurexin-3
PRO_0000019499

Regions

Topological domain28 – 15681541Extracellular Potential
Transmembrane1569 – 158921Helical; Potential
Topological domain1590 – 164354Cytoplasmic Potential
Domain28 – 202175Laminin G-like 1
Domain198 – 23538EGF-like 1
Domain258 – 440183Laminin G-like 2
Domain447 – 639193Laminin G-like 3
Domain643 – 68038EGF-like 2
Domain685 – 857173Laminin G-like 4
Domain871 – 1046176Laminin G-like 5
Domain1049 – 108638EGF-like 3
Domain1090 – 1260171Laminin G-like 6

Sites

Metal binding3041Calcium By similarity
Metal binding3211Calcium; via carbonyl oxygen By similarity
Metal binding3741Calcium; via carbonyl oxygen By similarity

Amino acid modifications

Glycosylation581N-linked (GlcNAc...) Potential
Glycosylation1051N-linked (GlcNAc...) Potential
Glycosylation7571N-linked (GlcNAc...) Potential
Glycosylation11891N-linked (GlcNAc...) Potential
Glycosylation12571N-linked (GlcNAc...) Potential
Glycosylation13011N-linked (GlcNAc...) Potential
Disulfide bond202 ↔ 213 By similarity
Disulfide bond207 ↔ 222 By similarity
Disulfide bond224 ↔ 234 By similarity
Disulfide bond404 ↔ 440 By similarity
Disulfide bond610 ↔ 639 By similarity
Disulfide bond647 ↔ 658 By similarity
Disulfide bond652 ↔ 667 By similarity
Disulfide bond669 ↔ 679 By similarity
Disulfide bond1018 ↔ 1046 By similarity
Disulfide bond1053 ↔ 1064 By similarity
Disulfide bond1058 ↔ 1073 By similarity
Disulfide bond1075 ↔ 1085 By similarity

Natural variations

Alternative sequence1 – 373373Missing in isoform 3a.
VSP_036463
Alternative sequence237 – 2426Missing in isoform 4a.
VSP_041699
Alternative sequence2521Q → QGRSK in isoform 4a.
VSP_041700
Alternative sequence750 – 75910DCIRINCNSS → G in isoform 4a.
VSP_041701
Alternative sequence12051T → TGNTDNERFQMVKQKIPFKY NRPVEEWLQEK in isoform 4a.
VSP_041702
Alternative sequence1334 – 1542209Missing in isoform 3a.
VSP_036464
Alternative sequence1335 – 137339TGGEL…PLLTI → GRSARSSNAARSLRAALTWT WRLTYTFTPIIFISCVVHS in isoform 4a.
VSP_041703
Alternative sequence1374 – 1643270Missing in isoform 4a.
VSP_041704

Experimental info

Sequence conflict10431E → K in BAA34463. Ref.3
Sequence conflict10431E → K in AAI52458. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1a [UniParc].

Last modified March 3, 2009. Version 4.
Checksum: E7360348E263C6EC

FASTA1,643180,599
        10         20         30         40         50         60 
MSSTLHSVFF TLKVSILLGS LLGLCLGLEF MGLPNQWARY LRWDASTRSD LSFQFKTNVS 

        70         80         90        100        110        120 
TGLLLYLDDG GVCDFLCLSL VDGRVQLRFS MDCAETAVLS NKQVNDSSWH FLMVSRDRLR 

       130        140        150        160        170        180 
TVLMLDGEGQ SGELQPQRPY MDVVSDLFLG GVPTDIRPSA LTLDGVQAMP GFKGLILDLK 

       190        200        210        220        230        240 
YGNSEPRLLG SRGVQMDAEG PCGERPCENG GICFLLDGHP TCDCSTTGYG GKLCSEDVSQ 

       250        260        270        280        290        300 
DPGLSHLMMS EQAREENVAT FRGSEYLCYD LSQNPIQSSS DEITLSFKTW QRNGLILHTG 

       310        320        330        340        350        360 
KSADYVNLAL KDGAVSLVIN LGSGAFEAIV EPVNGKFNDN AWHDVKVTRN LRQVTISVDG 

       370        380        390        400        410        420 
ILTTTGYTQE DYTMLGSDDF FYVGGSPSTA DLPGSPVSNN FMGCLKEVVY KNNDIRLELS 

       430        440        450        460        470        480 
RLARIADTKM KIYGEVVFKC ENVATLDPIN FETPEAYISL PKWNTKRMGS ISFDFRTTEP 

       490        500        510        520        530        540 
NGLILFTHGK PQERKDARSQ KNTKVDFFAV ELLDGNLYLL LDMGSGTIKV KATQKKANDG 

       550        560        570        580        590        600 
EWYHVDIQRD GRSGTISVNS RRTPFTASGE SEILDLEGDM YLGGLPENRA GLILPTELWT 

       610        620        630        640        650        660 
AMLNYGYVGC IRDLFIDGRS KNIRQLAEMQ NAAGVKSSCS RMSAKQCDSY PCKNNAVCKD 

       670        680        690        700        710        720 
GWNRFICDCT GTGYWGRTCE REASILSYDG SMYMKIIMPM VMHTEAEDVS FRFMSQRAYG 

       730        740        750        760        770        780 
LLVATTSRDS ADTLRLELDG GRVKLMVNLD CIRINCNSSK GPETLYAGQK LNDNEWHTVR 

       790        800        810        820        830        840 
VVRRGKSLKL TVDDDVAEGT MVGDHTRLEF HNIETGIMTE KRYISVVPSS FIGHLQSLMF 

       850        860        870        880        890        900 
NGLLYIDLCK NGDIDYCELK ARFGLRNIIA DPVTFKTKSS YLSLATLQAY TSMHLFFQFK 

       910        920        930        940        950        960 
TTSPDGFILF NSGDGNDFIA VELVKGYIHY VFDLGNGPNV IKGNSDRPLN DNQWHNVVIT 

       970        980        990       1000       1010       1020 
RDNSNTHSLK VDTKVVTQVI NGAKNLDLKG DLYMAGLAQG MYSNLPKLVA SRDGFQGCLA 

      1030       1040       1050       1060       1070       1080 
SVDLNGRLPD LINDALHRSG QIERGCEGPS TTCQEDSCAN QGVCMQQWEG FTCDCSMTSY 

      1090       1100       1110       1120       1130       1140 
SGNQCNDPGA TYIFGKSGGL ILYTWPANDR PSTRSDRLAV GFSTTVKDGI LVRIDSAPGL 

      1150       1160       1170       1180       1190       1200 
GDFLQLHIEQ GKIGVVFNIG TVDISIKEER TPVNDGKYHV VRFTRNGGNA TLQVDNWPVN 

      1210       1220       1230       1240       1250       1260 
EHYPTGRQLT IFNTQAQIAI GGKDKGRLFQ GQLSGLYYDG LKVLNMAAEN NPNIKINGSV 

      1270       1280       1290       1300       1310       1320 
RLVGEVPSIL GTTQTTSMPP EMSTTVMETT TTMATTTTRK NRSTASIQPT SDDLVSSAEC 

      1330       1340       1350       1360       1370       1380 
SSDDEDFVEC EPSTTGGELV IPLLVEDPLA TPPIATRAPS ITLPPTFRPL LTIIETTKDS 

      1390       1400       1410       1420       1430       1440 
LSMTSEAGLP CLSDQGSDGC DDDGLVISGY GSGETFDSNL PPTDDEDFYT TFSLVTDKSL 

      1450       1460       1470       1480       1490       1500 
STSIFEGGYK AHAPKWESKD FRPNKVSETS RTTTTSLSPE LIRFTASSSS GMVPKLPAGK 

      1510       1520       1530       1540       1550       1560 
MNNRDLKPQP DIVLLPLPTA YELDSTKLKS PLITSPMFRN VPTANPTEPG IRRVPGASEV 

      1570       1580       1590       1600       1610       1620 
IRESSSTTGM VVGIVAAAAL CILILLYAMY KYRNRDEGSY QVDETRNYIS NSAQSNGTLM 

      1630       1640 
KEKQQSSKSG HKKQKNKDRE YYV 

« Hide

Isoform 3a [UniParc].

Checksum: 5BB0495CAE63A1AD
Show »

FASTA1,061117,317
Isoform 4a [UniParc].

Checksum: 32D1B3F77340C23D
Show »

FASTA1,392153,885
Isoform 1b [UniParc].

See Q9HDB5.

Isoform 2b [UniParc].

See Q9HDB5.

Isoform 3b [UniParc].

See Q9HDB5.

Isoform 4b [UniParc].

See Q9HDB5.

References

« Hide 'large scale' references
[1]"Identification and characterization of heart-specific splicing of human neurexin 3 mRNA (NRXN3)."
Occhi G., Rampazzo A., Beffagna G., Antonio Danieli G.
Biochem. Biophys. Res. Commun. 298:151-155(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4A), TISSUE SPECIFICITY.
Tissue: Heart.
[2]"Analysis of the human neurexin genes: alternative splicing and the generation of protein diversity."
Rowen L., Young J., Birditt B., Kaur A., Madan A., Philipps D.L., Qin S., Minx P., Wilson R.K., Hood L., Graveley B.R.
Genomics 79:587-597(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING.
[3]"Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3A).
Tissue: Brain.
[4]"The DNA sequence and analysis of human chromosome 14."
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. expand/collapse author list , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3A).
[7]"The synaptic proteins neurexins and neuroligins are widely expressed in the vascular system and contribute to its functions."
Bottos A., Destro E., Rissone A., Graziano S., Cordara G., Assenzio B., Cera M.R., Mascia L., Bussolino F., Arese M.
Proc. Natl. Acad. Sci. U.S.A. 106:20782-20787(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ316284 mRNA. Translation: CAC87720.2.
AF099810 Genomic DNA. Translation: AAC68909.1.
AF123462 Genomic DNA. Translation: AAD13621.1.
AB018286 mRNA. Translation: BAA34463.2. Different initiation.
AC008056 Genomic DNA. Translation: AAF09143.1.
AC012099 Genomic DNA. Translation: AAF15058.1.
AC009396 Genomic DNA. Translation: AAF21147.1.
AC008045 Genomic DNA. Translation: AAF28465.1.
AC011440 Genomic DNA. Translation: AAF61277.1.
AC026888 Genomic DNA. Translation: AAF87841.1.
CH471061 Genomic DNA. Translation: EAW81316.1.
BC152457 mRNA. Translation: AAI52458.1.
CCDSCCDS9870.1. [Q9Y4C0-3]
RefSeqNP_004787.2. NM_004796.5. [Q9Y4C0-3]
UniGeneHs.368307.

3D structure databases

ProteinModelPortalQ9Y4C0.
SMRQ9Y4C0. Positions 38-1266.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114770. 5 interactions.
IntActQ9Y4C0. 1 interaction.

PTM databases

PhosphoSiteQ9Y4C0.

Polymorphism databases

DMDM224471902.

Proteomic databases

PaxDbQ9Y4C0.
PRIDEQ9Y4C0.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000335750; ENSP00000338349; ENSG00000021645. [Q9Y4C0-3]
ENST00000554719; ENSP00000451648; ENSG00000021645. [Q9Y4C0-3]
ENST00000554738; ENSP00000450683; ENSG00000021645. [Q9Y4C0-4]
GeneID9369.
KEGGhsa:9369.
UCSCuc001xun.4. human. [Q9Y4C0-3]
uc010asv.1. human. [Q9Y4C0-4]

Organism-specific databases

CTD9369.
GeneCardsGC14P078710.
HGNCHGNC:8010. NRXN3.
HPAHPA002727.
MIM600567. gene.
neXtProtNX_Q9Y4C0.
PharmGKBPA31788.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG302266.
HOVERGENHBG052670.
KOK07377.
OMARDIKCGD.
OrthoDBEOG7XWPMM.
PhylomeDBQ9Y4C0.
TreeFamTF321302.

Gene expression databases

ArrayExpressQ9Y4C0.
BgeeQ9Y4C0.
CleanExHS_NRXN3.
GenevestigatorQ9Y4C0.

Family and domain databases

Gene3D2.60.120.200. 6 hits.
InterProIPR008985. ConA-like_lec_gl_sf.
IPR013320. ConA-like_subgrp.
IPR000742. EG-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR001791. Laminin_G.
IPR003585. Neurexin-like.
IPR027158. NRXN3.
IPR027789. Syndecan/Neurexin_dom.
[Graphical view]
PANTHERPTHR10127:SF405. PTHR10127:SF405. 1 hit.
PfamPF02210. Laminin_G_2. 6 hits.
PF01034. Syndecan. 1 hit.
[Graphical view]
SMARTSM00294. 4.1m. 1 hit.
SM00181. EGF. 3 hits.
SM00282. LamG. 6 hits.
[Graphical view]
SUPFAMSSF49899. SSF49899. 6 hits.
PROSITEPS00010. ASX_HYDROXYL. 1 hit.
PS50026. EGF_3. 3 hits.
PS50025. LAM_G_DOMAIN. 6 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSNRXN3. human.
GenomeRNAi9369.
NextBio35088.
SOURCESearch...

Entry information

Entry nameNRX3A_HUMAN
AccessionPrimary (citable) accession number: Q9Y4C0
Secondary accession number(s): A6NGR4 expand/collapse secondary AC list , A7MD34, O95378, Q8IUE3, Q9NS47, Q9P1V3, Q9P1V6, Q9UIE2, Q9UIE3, Q9ULA5, Q9Y486
Entry history
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: March 3, 2009
Last modified: July 9, 2014
This is version 145 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 14

Human chromosome 14: entries, gene names and cross-references to MIM