Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zonadhesin

Gene

ZAN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Binds in a species-specific manner to the zona pellucida of the egg. May be involved in gamete recognition and/or signaling.

GO - Biological processi

  • binding of sperm to zona pellucida Source: UniProtKB
  • single organismal cell-cell adhesion Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

BioCyciZFISH:ENSG00000146839-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Zonadhesin
Gene namesi
Name:ZAN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:12857. ZAN.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini18 – 2757ExtracellularSequence analysisAdd BLAST2740
Transmembranei2758 – 2778HelicalSequence analysisAdd BLAST21
Topological domaini2779 – 2812CytoplasmicSequence analysisAdd BLAST34

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37446.

Polymorphism and mutation databases

BioMutaiZAN.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 17Sequence analysisAdd BLAST17
ChainiPRO_000000778318 – 2812ZonadhesinAdd BLAST2795

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi333N-linked (GlcNAc...)Sequence analysis1
Glycosylationi493N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1112N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1188N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1685N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1804N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1900N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1946N-linked (GlcNAc...)Sequence analysis1
Glycosylationi2203N-linked (GlcNAc...)Sequence analysis1
Glycosylationi2542N-linked (GlcNAc...)Sequence analysis1
Glycosylationi2701N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi2712 ↔ 2723By similarity
Disulfide bondi2717 ↔ 2732By similarity
Disulfide bondi2734 ↔ 2743By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiQ9Y493.

PTM databases

iPTMnetiQ9Y493.
PhosphoSitePlusiQ9Y493.

Expressioni

Tissue specificityi

In testis, primarily in haploid spermatids.

Gene expression databases

BgeeiENSG00000146839.

Interactioni

Subunit structurei

Probably forms covalent oligomers.

Protein-protein interaction databases

MINTiMINT-4658080.

Structurei

3D structure databases

ProteinModelPortaliQ9Y493.
SMRiQ9Y493.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini39 – 204MAM 1PROSITE-ProRule annotationAdd BLAST166
Domaini209 – 368MAM 2PROSITE-ProRule annotationAdd BLAST160
Domaini371 – 536MAM 3PROSITE-ProRule annotationAdd BLAST166
Domaini1044 – 1093TIL 1Add BLAST50
Domaini1103 – 1148VWFC 1Add BLAST46
Domaini1155 – 1371VWFD 1PROSITE-ProRule annotationAdd BLAST217
Domaini1426 – 1479TIL 2Add BLAST54
Domaini1480 – 1535VWFC 2Add BLAST56
Domaini1541 – 1758VWFD 2PROSITE-ProRule annotationAdd BLAST218
Domaini1812 – 1867TIL 3Add BLAST56
Domaini1868 – 1924VWFC 3Add BLAST57
Domaini1930 – 2144VWFD 3PROSITE-ProRule annotationAdd BLAST215
Domaini2211 – 2267TIL 4Add BLAST57
Domaini2268 – 2329VWFC 4Add BLAST62
Domaini2330 – 2537VWFD 4PROSITE-ProRule annotationAdd BLAST208
Domaini2652 – 2797VWFC 5Add BLAST146
Domaini2708 – 2744EGF-likePROSITE-ProRule annotationAdd BLAST37

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni573 – 104166 X heptapeptide repeats (approximate) (mucin-like domain)Add BLAST469

Domaini

The MAM domains probably mediate sperm adhesion to the zona pellucida.
During sperm migration through the reproductive tracts, the mucin-like domain might inhibit inappropriate trapping of spermatozoa or promoting adhesion to the oviductal isthmus.
The VWFD domain 2 may mediate covalent oligomerization.By similarity

Sequence similaritiesi

Contains 1 EGF-like domain.PROSITE-ProRule annotation
Contains 3 MAM domains.PROSITE-ProRule annotation
Contains 5 VWFC domains.Curated
Contains 4 VWFD domains.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

HOVERGENiHBG000375.
InParanoidiQ9Y493.
PhylomeDBiQ9Y493.

Family and domain databases

CDDicd06263. MAM. 3 hits.
InterProiIPR013320. ConA-like_dom.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR000998. MAM_dom.
IPR002919. TIL_dom.
IPR025615. TILa_dom.
IPR014853. Unchr_dom_Cys-rich.
IPR001007. VWF_dom.
IPR001846. VWF_type-D.
[Graphical view]
PfamiPF08742. C8. 4 hits.
PF00629. MAM. 3 hits.
PF01826. TIL. 4 hits.
PF12714. TILa. 5 hits.
PF00094. VWD. 4 hits.
[Graphical view]
SMARTiSM00832. C8. 4 hits.
SM00181. EGF. 4 hits.
SM00137. MAM. 3 hits.
SM00214. VWC. 4 hits.
SM00215. VWC_out. 4 hits.
SM00216. VWD. 4 hits.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 3 hits.
SSF57567. SSF57567. 4 hits.
PROSITEiPS00022. EGF_1. 1 hit.
PS01186. EGF_2. 4 hits.
PS50026. EGF_3. 1 hit.
PS00740. MAM_1. 1 hit.
PS50060. MAM_2. 3 hits.
PS51233. VWFD. 4 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q9Y493-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVPPVWTLLL LVGAALFRKE KPPDQKLVVR SSRDNYVLTQ CDFEDDAKPL
60 70 80 90 100
CDWSQVSADD EDWVRASGPS PTGSTGAPGG YPNGEGSYLH MESNSFHRGG
110 120 130 140 150
VARLLSPDLW EQGPLCVHFA HHMFGLSWGA QLRLLLLSGE EGRRPDVLWK
160 170 180 190 200
HWNTQRPSWM LTTVTVPAGF TLPTRLMFEG TRGSTAYLDI ALDALSIRRG
210 220 230 240 250
SCNRVCMMQT CSFDIPNDLC DWTWIPTASG AKWTQKKGSS GKPGVGPDGD
260 270 280 290 300
FSSPGSGCYM LLDPKNARPG QKAVLLSPVS LSSGCLSFSF HYILRGQSPG
310 320 330 340 350
AALHIYASVL GSIRKHTLFS GQPGPNWQAV SVNYTAVGRI QFAVVGVFGK
360 370 380 390 400
TPEPAVAVDA TSIAPCGEGF PQCDFEDNAH PFCDWVQTSG DGGHWALGHK
410 420 430 440 450
NGPVHGMGPA GGFPNAGGHY IYLEADEFSQ AGQSVRLVSR PFCAPGDICV
460 470 480 490 500
EFAYHMYGLG EGTMLELLLG SPAGSPPIPL WKRVGSQRPY WQNTSVTVPS
510 520 530 540 550
GHQQPMQLIF KGIQGSNTAS VVAMGFILIN PGTCPVKVLP ELPPVSPVSS
560 570 580 590 600
TGPSETTGLT ENPTISTKKP TVSIEKPSVT TEKPTVPKEK PTIPTEKPTI
610 620 630 640 650
STEKPTIPSE KPNMPSEKPT IPSEKPTILT EKPTIPSEKP TIPSEKPTIS
660 670 680 690 700
TEKPTVPTEE PTTPTEETTT SMEEPVIPTE KPSIPTEKPS IPTEKPTISM
710 720 730 740 750
EETIISTEKP TISPEKPTIP TEKPTIPTEK STISPEKPTT PTEKPTIPTE
760 770 780 790 800
KPTISPEKPT TPTEKPTISP EKLTIPTEKP TIPTEKPTIP TEKPTISTEE
810 820 830 840 850
PTTPTEETTI STEKPSIPME KPTLPTEETT TSVEETTIST EKLTIPMEKP
860 870 880 890 900
TISTEKPTIP TEKPTISPEK LTIPTEKLTI PTEKPTIPIE ETTISTEKLT
910 920 930 940 950
IPTEKPTISP EKPTISTEKP TIPTEKPTIP TEETTISTEK LTIPTEKPTI
960 970 980 990 1000
SPEKLTIPTE KPTISTEKPT IPTEKLTIPT EKPTIPTEKP TIPTEKLTAL
1010 1020 1030 1040 1050
RPPHPSPTAT GLAALVMSPH APSTPMTSVI LGTTTTSRSS TERCPPNARY
1060 1070 1080 1090 1100
ESCACPASCK SPRPSCGPLC REGCVCNPGF LFSDNHCIQA SSCNCFYNND
1110 1120 1130 1140 1150
YYEPGAEWFS PNCTEHCRCW PGSRVECQIS QCGTHTVCQL KNGQYGCHPY
1160 1170 1180 1190 1200
AGTATCLVYG DPHYVTFDGR HFGFMGKCTY ILAQPCGNST DPFFRVTAKN
1210 1220 1230 1240 1250
EEQGQEGVSC LSKVYVTLPE STVTLLKGRR TLVGGQQVTL PAIPSKGVFL
1260 1270 1280 1290 1300
GASGRFVELQ TEFGLRVRWD GDQQLYVTVS STYSGKLCGL CGNYDGNSDN
1310 1320 1330 1340 1350
DHLKLDGSPA GDKEELGNSW QTDQDEDQEC QKYQVVNSPS CDSSLQSSMS
1360 1370 1380 1390 1400
GPGFCGRLVD THGPFETCLL HVKAASFFDS CMLDMCGFQG LQHLLCTHMS
1410 1420 1430 1440 1450
TMTTTCQDAG HAVKPWREPH FCPMACPPNS KYSLCAKPCP DTCHSGFSGM
1460 1470 1480 1490 1500
FCSDRCVEAC ECNPGFVLSG LECIPRSQCG CLHPAGSYFK VGERWYKPGC
1510 1520 1530 1540 1550
KELCVCESNN RIRCQPWRCR AQEFCGQQDG IYGCHAQGAA TCTASGDPHY
1560 1570 1580 1590 1600
LTFDGALHHF MGTCTYVLTR PCWSRSQDSY FVVSATNENR GGILEVSYIK
1610 1620 1630 1640 1650
AVHVTVFDLS ISLLRGCKVM LNGHRVALPV WLAQGRVTIR LSSNLVLLYT
1660 1670 1680 1690 1700
NFGLQVRYDG SHLVEVTVPS SYGGQLCGLC GNYNNNSLDD NLRPDRKLAG
1710 1720 1730 1740 1750
DSMQLGAAWK LPESSEPGCF LVGGKPSSCQ ENSMADAWNK NCAILINPQG
1760 1770 1780 1790 1800
PFSQCHQVVP PQSSFASCVH GQCGTKGDTT ALCRSLQAYA SLCAQAGQAP
1810 1820 1830 1840 1850
AWRNRTFCPM RCPPGSSYSP CSSPCPDTCS SINNPRDCPK ALPCAESCEC
1860 1870 1880 1890 1900
QKGHILSGTS CVPLGQCGCT DPAGSYHPVG ERWYTENTCT RLCTCSVHNN
1910 1920 1930 1940 1950
ITCFQSTCKP NQICWALDGL LRCRASGVGV CQLPGESHYV SFDGSNHSIP
1960 1970 1980 1990 2000
DACTLVLVKV CHPAMALPFF KISAKHEKEE GGTEAFRLHE VYIDIYDAQV
2010 2020 2030 2040 2050
TLQKGHRVLI NSKQVTLPAI SQIPGVSVKS SSIYSIVNIK IGVQVKFDGN
2060 2070 2080 2090 2100
HLLEIEIPTT YYGKVCGMCG NFNDEEEDEL MMPSDEVANS DSEFVNSWKD
2110 2120 2130 2140 2150
KDIDPSCQSL LVDEQQIPAE QQENPSGNCR AADLRRAREK CEAALRAPVW
2160 2170 2180 2190 2200
AQCASRIDLT PFLVDCANTL CEFGGLYQAL CQALQAFGAT CQSQGLKPPL
2210 2220 2230 2240 2250
WRNSSFCPLE CPAYSSYTNC LPSCSPSCWD LDGRCEGAKV PSACAEGCIC
2260 2270 2280 2290 2300
QPGYVLSEDK CVPRSQCGCK DAHGGSIPLG KSWVSSGCTE KCVCTGGAIQ
2310 2320 2330 2340 2350
CGDFRCPSGS HCQLTSDNSN SNCVSDKSEQ CSVYGDPRYL TFDGFSYRLQ
2360 2370 2380 2390 2400
GRMTYVLIKT VDVLPEGVEP LLVEGRNKMD PPRSSIFLQE VITTVYGYKV
2410 2420 2430 2440 2450
QLQAGLELVV NNQKMAVPYR PNEHLRVTLW GQRLYLVTDF ELVVSFGGRK
2460 2470 2480 2490 2500
NAVISLPSMY EGLVSGLCGN YDKNRKNDMM LPSGALTQNL NTFGNSWEVK
2510 2520 2530 2540 2550
TEDALLRFPR AIPAEEEGQG AELGLRTGLQ VSECSPEQLA SNSTQACRVL
2560 2570 2580 2590 2600
ADPQGPFAAC HQTVAPEPFQ EHCVLDLCSA QDPREQEELR CQVLSGHGVS
2610 2620 2630 2640 2650
SRYHISELYD TLPSILCQPG RPRGLRGPLR GRLRQHPRLC LQWHPEPPLA
2660 2670 2680 2690 2700
DCGCTSNGIY YQLGSSFLTE DCSQRCTCAS SRILLCEPFS CRAGEVCTLG
2710 2720 2730 2740 2750
NHTQGCFPES PCLQNPCQND GQCREQGATF TCECEVGYGG GLCMEPRDAP
2760 2770 2780 2790 2800
PPRKPASNLV AVLLGLLVPV VVVLLAVTRE CIYRTRRKRE KTQEGDRLAR
2810
LVDTDTVLDC AC
Length:2,812
Mass (Da):305,663
Last modified:March 8, 2011 - v4
Checksum:i912FBE459AFC3302
GO
Isoform 1 (identifier: Q9Y493-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2724: HGVSSRYHIS...NPCQNDGQCR → YAILCQEAGA...PFLAGQQLSD
     2725-2812: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:2,724
Mass (Da):295,261
Checksum:i74016809A5DF2331
GO
Isoform 2 (identifier: Q9Y493-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2689: HGVSSRYHIS...SSRILLCEPF → YAILCQEAGA...ASTTSWAAAF
     2690-2812: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:2,689
Mass (Da):291,356
Checksum:i7E12C3343BFD408C
GO
Isoform 4 (identifier: Q9Y493-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2624: HGVSSRYHISELYDTLPSILCQPGRPRG → YAILCQEAGAALAGWRDRTLCAGQQLSD
     2625-2812: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:2,624
Mass (Da):284,848
Checksum:i1ABB2256CC5A2BA3
GO
Isoform 5 (identifier: Q9Y493-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2601: HGVSS → WAAAF
     2602-2812: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:2,601
Mass (Da):282,431
Checksum:i6B97B524C67AABF4
GO
Isoform 6 (identifier: Q9Y493-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2617: HGVSSRYHISELYDTLPSILC → YAILCQEAGAALAGWRDRTLC
     2618-2708: Missing.

Show »
Length:2,721
Mass (Da):295,509
Checksum:i142E9CBF3D404EC3
GO
Isoform 7 (identifier: Q9Y493-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2636: HGVSSRYHIS...GPLRGRLRQH → YAILCQEAGA...EGPCVEGCAD
     2663-2666: LGSS → VRAGSRRPWGAEAPRRARPGMELERLLLALPFLAGQQ

Show »
Length:2,866
Mass (Da):311,094
Checksum:iC31893BFC621EF6C
GO

Sequence cautioni

The sequence AAC78790 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAW76487 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAW76488 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAW76489 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAW76490 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAW76491 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAW76492 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1922R → H in AAL04410 (PubMed:17033959).Curated1
Sequence conflicti1922R → H in AAL04411 (PubMed:17033959).Curated1
Sequence conflicti1922R → H in AAL04412 (PubMed:17033959).Curated1
Sequence conflicti1922R → H in AAL04413 (PubMed:17033959).Curated1
Sequence conflicti1922R → H in AAL04414 (PubMed:17033959).Curated1
Sequence conflicti1922R → H in AAL04415 (PubMed:17033959).Curated1
Sequence conflicti1922R → H in ABJ98522 (PubMed:17033959).Curated1
Sequence conflicti1922R → H in AAC78790 (PubMed:9799793).Curated1
Sequence conflicti1922R → H in AAK21011 (PubMed:11239002).Curated1
Sequence conflicti2430W → R in AAL04410 (PubMed:17033959).Curated1
Sequence conflicti2430W → R in AAL04411 (PubMed:17033959).Curated1
Sequence conflicti2430W → R in AAL04412 (PubMed:17033959).Curated1
Sequence conflicti2430W → R in AAL04413 (PubMed:17033959).Curated1
Sequence conflicti2430W → R in AAL04414 (PubMed:17033959).Curated1
Sequence conflicti2430W → R in AAL04415 (PubMed:17033959).Curated1
Sequence conflicti2430W → R in ABJ98522 (PubMed:17033959).Curated1
Sequence conflicti2430W → R in AAK21011 (PubMed:11239002).Curated1
Sequence conflicti2430W → R in AAC51208 (PubMed:9126492).Curated1
Sequence conflicti2555G → A in AAC51208 (PubMed:9126492).Curated1
Sequence conflicti2565A → P in AAC51208 (PubMed:9126492).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06458416L → F.Corresponds to variant rs12673246dbSNPEnsembl.1
Natural variantiVAR_061162113G → A.Corresponds to variant rs34828430dbSNPEnsembl.1
Natural variantiVAR_055785412G → S.Corresponds to variant rs17162408dbSNPEnsembl.1
Natural variantiVAR_064585430Q → H.2 PublicationsCorresponds to variant rs221833dbSNPEnsembl.1
Natural variantiVAR_055786690S → T.Corresponds to variant rs13241461dbSNPEnsembl.1
Natural variantiVAR_0557871012L → R.Corresponds to variant rs6942733dbSNPEnsembl.1
Natural variantiVAR_0557881096F → C.Corresponds to variant rs221823dbSNPEnsembl.1
Natural variantiVAR_0557891375A → T.Corresponds to variant rs2293767dbSNPEnsembl.1
Natural variantiVAR_0557901674G → C.Corresponds to variant rs10953303dbSNPEnsembl.1
Natural variantiVAR_0557911698L → P.Corresponds to variant rs10247980dbSNPEnsembl.1
Natural variantiVAR_0557921742C → R.Corresponds to variant rs17147735dbSNPEnsembl.1
Natural variantiVAR_0557931878P → S.Corresponds to variant rs314298dbSNPEnsembl.1
Natural variantiVAR_0557941903C → Y.Corresponds to variant rs12673041dbSNPEnsembl.1
Natural variantiVAR_0645861922R → C.Corresponds to variant rs314299dbSNPEnsembl.1
Natural variantiVAR_0645871969F → L.3 PublicationsCorresponds to variant rs542137dbSNPEnsembl.1
Natural variantiVAR_0592781995I → M.1 PublicationCorresponds to variant rs541275dbSNPEnsembl.1
Natural variantiVAR_0645882035S → T.3 PublicationsCorresponds to variant rs539445dbSNPEnsembl.1
Natural variantiVAR_0592792073N → S.Corresponds to variant rs314300dbSNPEnsembl.1
Natural variantiVAR_0645892111L → P.3 PublicationsCorresponds to variant rs531503dbSNPEnsembl.1
Natural variantiVAR_0611632334Y → S.Corresponds to variant rs60783739dbSNPEnsembl.1
Natural variantiVAR_0611642349L → F.Corresponds to variant rs59541653dbSNPEnsembl.1
Natural variantiVAR_0592802527T → M.Corresponds to variant rs3847059dbSNPEnsembl.1
Natural variantiVAR_0592812643W → R.Corresponds to variant rs314339dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0014302597 – 2724HGVSS…DGQCR → YAILCQEAGAALAGWRDRTL CAMECPAGTIYQSCMTPCPA SCANLADPGDCEGPCVEGCA SIPGYAYSGTQSLPWLTVAA PAMASTTRSELAAGGPGEQR RQGEPDQGWNWNVSSWPFPF LAGQQLSD in isoform 1. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_0014282597 – 2689HGVSS…LCEPF → YAILCQEAGAALAGWRDRTL CAMECPAGTIYQSCMTPCPA SCANLADPGDCEGPCVEGCA SIPGYAYSGTQSLPWLTVAA PAMASTTSWAAAF in isoform 2. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_0014262597 – 2636HGVSS…RLRQH → YAILCQEAGAALAGWRDRTL CAMECPAGTIYQSCMTPCPA SCANLADPGDCEGPCVEGCA D in isoform 7. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_0014242597 – 2624HGVSS…GRPRG → YAILCQEAGAALAGWRDRTL CAGQQLSD in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0014222597 – 2617HGVSS…PSILC → YAILCQEAGAALAGWRDRTL C in isoform 6. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_0014202597 – 2601HGVSS → WAAAF in isoform 5. 1 Publication5
Alternative sequenceiVSP_0014212602 – 2812Missing in isoform 5. 1 PublicationAdd BLAST211
Alternative sequenceiVSP_0014232618 – 2708Missing in isoform 6. 1 PublicationAdd BLAST91
Alternative sequenceiVSP_0014252625 – 2812Missing in isoform 4. 1 PublicationAdd BLAST188
Alternative sequenceiVSP_0014272663 – 2666LGSS → VRAGSRRPWGAEAPRRARPG MELERLLLALPFLAGQQ in isoform 7. 1 Publication4
Alternative sequenceiVSP_0014292690 – 2812Missing in isoform 2. 1 PublicationAdd BLAST123
Alternative sequenceiVSP_0014312725 – 2812Missing in isoform 1. 1 PublicationAdd BLAST88

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF332975 mRNA. Translation: AAK01431.1.
AF332976 mRNA. Translation: AAK01432.1.
AF332977 mRNA. Translation: AAK01433.1.
AF332978 mRNA. Translation: AAK01434.1.
AF332979 mRNA. Translation: AAK01435.1.
AF332980 mRNA. Translation: AAK01436.1.
EF025894 Genomic DNA. Translation: ABJ98522.1.
AY046055 Genomic DNA. Translation: AAL04410.1.
AY046055 Genomic DNA. Translation: AAL04411.1.
AY046055 Genomic DNA. Translation: AAL04412.1.
AY046055 Genomic DNA. Translation: AAL04413.1.
AY046055 Genomic DNA. Translation: AAL04414.1.
AY046055 Genomic DNA. Translation: AAL04415.1.
AC009488 Genomic DNA. No translation available.
AC011895 Genomic DNA. No translation available.
CH471091 Genomic DNA. Translation: EAW76487.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76488.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76489.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76490.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76491.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76492.1. Sequence problems.
AF053356 Genomic DNA. Translation: AAC78790.1. Sequence problems.
AF312032 Genomic DNA. Translation: AAK21011.1.
U83191 mRNA. Translation: AAC51208.1.
CCDSiCCDS47663.2. [Q9Y493-6]
CCDS47664.2. [Q9Y493-1]
RefSeqiNP_003377.2. NM_003386.2.
NP_775082.2. NM_173059.2.
UniGeneiHs.307004.

Genome annotation databases

EnsembliENST00000348028; ENSP00000423579; ENSG00000146839.
ENST00000349350; ENSP00000422387; ENSG00000146839.
ENST00000421100; ENSP00000425454; ENSG00000146839.
ENST00000427578; ENSP00000425200; ENSG00000146839.
ENST00000443370; ENSP00000421245; ENSG00000146839.
ENST00000449052; ENSP00000422208; ENSG00000146839.
GeneIDi7455.
KEGGihsa:7455.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF332975 mRNA. Translation: AAK01431.1.
AF332976 mRNA. Translation: AAK01432.1.
AF332977 mRNA. Translation: AAK01433.1.
AF332978 mRNA. Translation: AAK01434.1.
AF332979 mRNA. Translation: AAK01435.1.
AF332980 mRNA. Translation: AAK01436.1.
EF025894 Genomic DNA. Translation: ABJ98522.1.
AY046055 Genomic DNA. Translation: AAL04410.1.
AY046055 Genomic DNA. Translation: AAL04411.1.
AY046055 Genomic DNA. Translation: AAL04412.1.
AY046055 Genomic DNA. Translation: AAL04413.1.
AY046055 Genomic DNA. Translation: AAL04414.1.
AY046055 Genomic DNA. Translation: AAL04415.1.
AC009488 Genomic DNA. No translation available.
AC011895 Genomic DNA. No translation available.
CH471091 Genomic DNA. Translation: EAW76487.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76488.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76489.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76490.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76491.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76492.1. Sequence problems.
AF053356 Genomic DNA. Translation: AAC78790.1. Sequence problems.
AF312032 Genomic DNA. Translation: AAK21011.1.
U83191 mRNA. Translation: AAC51208.1.
CCDSiCCDS47663.2. [Q9Y493-6]
CCDS47664.2. [Q9Y493-1]
RefSeqiNP_003377.2. NM_003386.2.
NP_775082.2. NM_173059.2.
UniGeneiHs.307004.

3D structure databases

ProteinModelPortaliQ9Y493.
SMRiQ9Y493.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-4658080.

PTM databases

iPTMnetiQ9Y493.
PhosphoSitePlusiQ9Y493.

Polymorphism and mutation databases

BioMutaiZAN.

Proteomic databases

PRIDEiQ9Y493.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000348028; ENSP00000423579; ENSG00000146839.
ENST00000349350; ENSP00000422387; ENSG00000146839.
ENST00000421100; ENSP00000425454; ENSG00000146839.
ENST00000427578; ENSP00000425200; ENSG00000146839.
ENST00000443370; ENSP00000421245; ENSG00000146839.
ENST00000449052; ENSP00000422208; ENSG00000146839.
GeneIDi7455.
KEGGihsa:7455.

Organism-specific databases

CTDi7455.
GeneCardsiZAN.
HGNCiHGNC:12857. ZAN.
MIMi602372. gene.
neXtProtiNX_Q9Y493.
PharmGKBiPA37446.
GenAtlasiSearch...

Phylogenomic databases

HOVERGENiHBG000375.
InParanoidiQ9Y493.
PhylomeDBiQ9Y493.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000146839-MONOMER.

Miscellaneous databases

GenomeRNAii7455.
PROiQ9Y493.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000146839.

Family and domain databases

CDDicd06263. MAM. 3 hits.
InterProiIPR013320. ConA-like_dom.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR000998. MAM_dom.
IPR002919. TIL_dom.
IPR025615. TILa_dom.
IPR014853. Unchr_dom_Cys-rich.
IPR001007. VWF_dom.
IPR001846. VWF_type-D.
[Graphical view]
PfamiPF08742. C8. 4 hits.
PF00629. MAM. 3 hits.
PF01826. TIL. 4 hits.
PF12714. TILa. 5 hits.
PF00094. VWD. 4 hits.
[Graphical view]
SMARTiSM00832. C8. 4 hits.
SM00181. EGF. 4 hits.
SM00137. MAM. 3 hits.
SM00214. VWC. 4 hits.
SM00215. VWC_out. 4 hits.
SM00216. VWD. 4 hits.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 3 hits.
SSF57567. SSF57567. 4 hits.
PROSITEiPS00022. EGF_1. 1 hit.
PS01186. EGF_2. 4 hits.
PS50026. EGF_3. 1 hit.
PS00740. MAM_1. 1 hit.
PS50060. MAM_2. 3 hits.
PS51233. VWFD. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZAN_HUMAN
AccessioniPrimary (citable) accession number: Q9Y493
Secondary accession number(s): A0FKC8
, D6W5W4, O00218, Q96L85, Q96L86, Q96L87, Q96L88, Q96L89, Q96L90, Q9BXN9, Q9BZ83, Q9BZ84, Q9BZ85, Q9BZ86, Q9BZ87, Q9BZ88
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: March 8, 2011
Last modified: November 2, 2016
This is version 142 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.