Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Y493 (ZAN_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 123. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zonadhesin
Gene names
Name:ZAN
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2812 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Binds in a species-specific manner to the zona pellucida of the egg. May be involved in gamete recognition and/or signaling.

Subunit structure

Probably forms covalent oligomers.

Subcellular location

Cell membrane; Single-pass type I membrane protein. Note: Exclusively on the apical region of the sperm head By similarity.

Tissue specificity

In testis, primarily in haploid spermatids.

Domain

The MAM domains probably mediate sperm adhesion to the zona pellucida.

During sperm migration through the reproductive tracts, the mucin-like domain might inhibit inappropriate trapping of spermatozoa or promoting adhesion to the oviductal isthmus.

The VWFD domain 2 may mediate covalent oligomerization By similarity.

Sequence similarities

Contains 1 EGF-like domain.

Contains 3 MAM domains.

Contains 4 TIL (trypsin inhibitory-like) domains.

Contains 5 VWFC domains.

Contains 4 VWFD domains.

Sequence caution

The sequence AAC78790.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence EAW76487.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence EAW76488.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence EAW76489.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence EAW76490.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence EAW76491.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence EAW76492.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 3 (identifier: Q9Y493-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 1 (identifier: Q9Y493-2)

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2724: HGVSSRYHIS...NPCQNDGQCR → YAILCQEAGA...PFLAGQQLSD
     2725-2812: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 2 (identifier: Q9Y493-3)

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2689: HGVSSRYHIS...SSRILLCEPF → YAILCQEAGA...ASTTSWAAAF
     2690-2812: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 4 (identifier: Q9Y493-4)

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2624: HGVSSRYHISELYDTLPSILCQPGRPRG → YAILCQEAGAALAGWRDRTLCAGQQLSD
     2625-2812: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 5 (identifier: Q9Y493-5)

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2601: HGVSS → WAAAF
     2602-2812: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 6 (identifier: Q9Y493-6)

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2617: HGVSSRYHISELYDTLPSILC → YAILCQEAGAALAGWRDRTLC
     2618-2708: Missing.
Isoform 7 (identifier: Q9Y493-7)

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2636: HGVSSRYHIS...GPLRGRLRQH → YAILCQEAGA...EGPCVEGCAD
     2663-2666: LGSS → VRAGSRRPWGAEAPRRARPGMELERLLLALPFLAGQQ

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1717 Potential
Chain18 – 28122795Zonadhesin
PRO_0000007783

Regions

Topological domain18 – 27572740Extracellular Potential
Transmembrane2758 – 277821Helical; Potential
Topological domain2779 – 281234Cytoplasmic Potential
Domain39 – 204166MAM 1
Domain209 – 368160MAM 2
Domain371 – 536166MAM 3
Domain1044 – 109350TIL 1
Domain1103 – 114846VWFC 1
Domain1155 – 1371217VWFD 1
Domain1426 – 147954TIL 2
Domain1480 – 153556VWFC 2
Domain1541 – 1758218VWFD 2
Domain1812 – 186756TIL 3
Domain1868 – 192457VWFC 3
Domain1930 – 2144215VWFD 3
Domain2211 – 226757TIL 4
Domain2268 – 232962VWFC 4
Domain2330 – 2537208VWFD 4
Domain2652 – 2797146VWFC 5
Domain2708 – 274437EGF-like
Region573 – 104146966 X heptapeptide repeats (approximate) (mucin-like domain)

Amino acid modifications

Glycosylation3331N-linked (GlcNAc...) Potential
Glycosylation4931N-linked (GlcNAc...) Potential
Glycosylation11121N-linked (GlcNAc...) Potential
Glycosylation11881N-linked (GlcNAc...) Potential
Glycosylation16851N-linked (GlcNAc...) Potential
Glycosylation18041N-linked (GlcNAc...) Potential
Glycosylation19001N-linked (GlcNAc...) Potential
Glycosylation19461N-linked (GlcNAc...) Potential
Glycosylation22031N-linked (GlcNAc...) Potential
Glycosylation25421N-linked (GlcNAc...) Potential
Glycosylation27011N-linked (GlcNAc...) Potential
Disulfide bond2712 ↔ 2723 By similarity
Disulfide bond2717 ↔ 2732 By similarity
Disulfide bond2734 ↔ 2743 By similarity

Natural variations

Alternative sequence2597 – 2724128HGVSS…DGQCR → YAILCQEAGAALAGWRDRTL CAMECPAGTIYQSCMTPCPA SCANLADPGDCEGPCVEGCA SIPGYAYSGTQSLPWLTVAA PAMASTTRSELAAGGPGEQR RQGEPDQGWNWNVSSWPFPF LAGQQLSD in isoform 1.
VSP_001430
Alternative sequence2597 – 268993HGVSS…LCEPF → YAILCQEAGAALAGWRDRTL CAMECPAGTIYQSCMTPCPA SCANLADPGDCEGPCVEGCA SIPGYAYSGTQSLPWLTVAA PAMASTTSWAAAF in isoform 2.
VSP_001428
Alternative sequence2597 – 263640HGVSS…RLRQH → YAILCQEAGAALAGWRDRTL CAMECPAGTIYQSCMTPCPA SCANLADPGDCEGPCVEGCA D in isoform 7.
VSP_001426
Alternative sequence2597 – 262428HGVSS…GRPRG → YAILCQEAGAALAGWRDRTL CAGQQLSD in isoform 4.
VSP_001424
Alternative sequence2597 – 261721HGVSS…PSILC → YAILCQEAGAALAGWRDRTL C in isoform 6.
VSP_001422
Alternative sequence2597 – 26015HGVSS → WAAAF in isoform 5.
VSP_001420
Alternative sequence2602 – 2812211Missing in isoform 5.
VSP_001421
Alternative sequence2618 – 270891Missing in isoform 6.
VSP_001423
Alternative sequence2625 – 2812188Missing in isoform 4.
VSP_001425
Alternative sequence2663 – 26664LGSS → VRAGSRRPWGAEAPRRARPG MELERLLLALPFLAGQQ in isoform 7.
VSP_001427
Alternative sequence2690 – 2812123Missing in isoform 2.
VSP_001429
Alternative sequence2725 – 281288Missing in isoform 1.
VSP_001431
Natural variant161L → F.
Corresponds to variant rs12673246 [ dbSNP | Ensembl ].
VAR_064584
Natural variant1131G → A.
Corresponds to variant rs34828430 [ dbSNP | Ensembl ].
VAR_061162
Natural variant4121G → S.
Corresponds to variant rs17162408 [ dbSNP | Ensembl ].
VAR_055785
Natural variant4301Q → H. Ref.2 Ref.5
Corresponds to variant rs221833 [ dbSNP | Ensembl ].
VAR_064585
Natural variant6901S → T.
Corresponds to variant rs13241461 [ dbSNP | Ensembl ].
VAR_055786
Natural variant10121L → R.
Corresponds to variant rs6942733 [ dbSNP | Ensembl ].
VAR_055787
Natural variant10961F → C.
Corresponds to variant rs221823 [ dbSNP | Ensembl ].
VAR_055788
Natural variant13751A → T.
Corresponds to variant rs2293767 [ dbSNP | Ensembl ].
VAR_055789
Natural variant16741G → C.
Corresponds to variant rs10953303 [ dbSNP | Ensembl ].
VAR_055790
Natural variant16981L → P.
Corresponds to variant rs10247980 [ dbSNP | Ensembl ].
VAR_055791
Natural variant17421C → R.
Corresponds to variant rs17147735 [ dbSNP | Ensembl ].
VAR_055792
Natural variant18781P → S.
Corresponds to variant rs314298 [ dbSNP | Ensembl ].
VAR_055793
Natural variant19031C → Y.
Corresponds to variant rs12673041 [ dbSNP | Ensembl ].
VAR_055794
Natural variant19221R → C.
Corresponds to variant rs314299 [ dbSNP | Ensembl ].
VAR_064586
Natural variant19691F → L. Ref.2 Ref.5 Ref.6
Corresponds to variant rs542137 [ dbSNP | Ensembl ].
VAR_064587
Natural variant19951I → M. Ref.5
Corresponds to variant rs541275 [ dbSNP | Ensembl ].
VAR_059278
Natural variant20351S → T. Ref.2 Ref.5 Ref.6
Corresponds to variant rs539445 [ dbSNP | Ensembl ].
VAR_064588
Natural variant20731N → S.
Corresponds to variant rs314300 [ dbSNP | Ensembl ].
VAR_059279
Natural variant21111L → P. Ref.2 Ref.5 Ref.6
Corresponds to variant rs531503 [ dbSNP | Ensembl ].
VAR_064589
Natural variant23341Y → S.
Corresponds to variant rs60783739 [ dbSNP | Ensembl ].
VAR_061163
Natural variant23491L → F.
Corresponds to variant rs59541653 [ dbSNP | Ensembl ].
VAR_061164
Natural variant25271T → M.
Corresponds to variant rs3847059 [ dbSNP | Ensembl ].
VAR_059280
Natural variant26431W → R.
Corresponds to variant rs314339 [ dbSNP | Ensembl ].
VAR_059281

Experimental info

Sequence conflict19221R → H in AAL04410. Ref.2
Sequence conflict19221R → H in AAL04411. Ref.2
Sequence conflict19221R → H in AAL04412. Ref.2
Sequence conflict19221R → H in AAL04413. Ref.2
Sequence conflict19221R → H in AAL04414. Ref.2
Sequence conflict19221R → H in AAL04415. Ref.2
Sequence conflict19221R → H in ABJ98522. Ref.2
Sequence conflict19221R → H in AAC78790. Ref.5
Sequence conflict19221R → H in AAK21011. Ref.6
Sequence conflict24301W → R in AAL04410. Ref.2
Sequence conflict24301W → R in AAL04411. Ref.2
Sequence conflict24301W → R in AAL04412. Ref.2
Sequence conflict24301W → R in AAL04413. Ref.2
Sequence conflict24301W → R in AAL04414. Ref.2
Sequence conflict24301W → R in AAL04415. Ref.2
Sequence conflict24301W → R in ABJ98522. Ref.2
Sequence conflict24301W → R in AAK21011. Ref.6
Sequence conflict24301W → R in AAC51208. Ref.7
Sequence conflict25551G → A in AAC51208. Ref.7
Sequence conflict25651A → P in AAC51208. Ref.7

Sequences

Sequence LengthMass (Da)Tools
Isoform 3 [UniParc].

Last modified March 8, 2011. Version 4.
Checksum: 912FBE459AFC3302

FASTA2,812305,663
        10         20         30         40         50         60 
MVPPVWTLLL LVGAALFRKE KPPDQKLVVR SSRDNYVLTQ CDFEDDAKPL CDWSQVSADD 

        70         80         90        100        110        120 
EDWVRASGPS PTGSTGAPGG YPNGEGSYLH MESNSFHRGG VARLLSPDLW EQGPLCVHFA 

       130        140        150        160        170        180 
HHMFGLSWGA QLRLLLLSGE EGRRPDVLWK HWNTQRPSWM LTTVTVPAGF TLPTRLMFEG 

       190        200        210        220        230        240 
TRGSTAYLDI ALDALSIRRG SCNRVCMMQT CSFDIPNDLC DWTWIPTASG AKWTQKKGSS 

       250        260        270        280        290        300 
GKPGVGPDGD FSSPGSGCYM LLDPKNARPG QKAVLLSPVS LSSGCLSFSF HYILRGQSPG 

       310        320        330        340        350        360 
AALHIYASVL GSIRKHTLFS GQPGPNWQAV SVNYTAVGRI QFAVVGVFGK TPEPAVAVDA 

       370        380        390        400        410        420 
TSIAPCGEGF PQCDFEDNAH PFCDWVQTSG DGGHWALGHK NGPVHGMGPA GGFPNAGGHY 

       430        440        450        460        470        480 
IYLEADEFSQ AGQSVRLVSR PFCAPGDICV EFAYHMYGLG EGTMLELLLG SPAGSPPIPL 

       490        500        510        520        530        540 
WKRVGSQRPY WQNTSVTVPS GHQQPMQLIF KGIQGSNTAS VVAMGFILIN PGTCPVKVLP 

       550        560        570        580        590        600 
ELPPVSPVSS TGPSETTGLT ENPTISTKKP TVSIEKPSVT TEKPTVPKEK PTIPTEKPTI 

       610        620        630        640        650        660 
STEKPTIPSE KPNMPSEKPT IPSEKPTILT EKPTIPSEKP TIPSEKPTIS TEKPTVPTEE 

       670        680        690        700        710        720 
PTTPTEETTT SMEEPVIPTE KPSIPTEKPS IPTEKPTISM EETIISTEKP TISPEKPTIP 

       730        740        750        760        770        780 
TEKPTIPTEK STISPEKPTT PTEKPTIPTE KPTISPEKPT TPTEKPTISP EKLTIPTEKP 

       790        800        810        820        830        840 
TIPTEKPTIP TEKPTISTEE PTTPTEETTI STEKPSIPME KPTLPTEETT TSVEETTIST 

       850        860        870        880        890        900 
EKLTIPMEKP TISTEKPTIP TEKPTISPEK LTIPTEKLTI PTEKPTIPIE ETTISTEKLT 

       910        920        930        940        950        960 
IPTEKPTISP EKPTISTEKP TIPTEKPTIP TEETTISTEK LTIPTEKPTI SPEKLTIPTE 

       970        980        990       1000       1010       1020 
KPTISTEKPT IPTEKLTIPT EKPTIPTEKP TIPTEKLTAL RPPHPSPTAT GLAALVMSPH 

      1030       1040       1050       1060       1070       1080 
APSTPMTSVI LGTTTTSRSS TERCPPNARY ESCACPASCK SPRPSCGPLC REGCVCNPGF 

      1090       1100       1110       1120       1130       1140 
LFSDNHCIQA SSCNCFYNND YYEPGAEWFS PNCTEHCRCW PGSRVECQIS QCGTHTVCQL 

      1150       1160       1170       1180       1190       1200 
KNGQYGCHPY AGTATCLVYG DPHYVTFDGR HFGFMGKCTY ILAQPCGNST DPFFRVTAKN 

      1210       1220       1230       1240       1250       1260 
EEQGQEGVSC LSKVYVTLPE STVTLLKGRR TLVGGQQVTL PAIPSKGVFL GASGRFVELQ 

      1270       1280       1290       1300       1310       1320 
TEFGLRVRWD GDQQLYVTVS STYSGKLCGL CGNYDGNSDN DHLKLDGSPA GDKEELGNSW 

      1330       1340       1350       1360       1370       1380 
QTDQDEDQEC QKYQVVNSPS CDSSLQSSMS GPGFCGRLVD THGPFETCLL HVKAASFFDS 

      1390       1400       1410       1420       1430       1440 
CMLDMCGFQG LQHLLCTHMS TMTTTCQDAG HAVKPWREPH FCPMACPPNS KYSLCAKPCP 

      1450       1460       1470       1480       1490       1500 
DTCHSGFSGM FCSDRCVEAC ECNPGFVLSG LECIPRSQCG CLHPAGSYFK VGERWYKPGC 

      1510       1520       1530       1540       1550       1560 
KELCVCESNN RIRCQPWRCR AQEFCGQQDG IYGCHAQGAA TCTASGDPHY LTFDGALHHF 

      1570       1580       1590       1600       1610       1620 
MGTCTYVLTR PCWSRSQDSY FVVSATNENR GGILEVSYIK AVHVTVFDLS ISLLRGCKVM 

      1630       1640       1650       1660       1670       1680 
LNGHRVALPV WLAQGRVTIR LSSNLVLLYT NFGLQVRYDG SHLVEVTVPS SYGGQLCGLC 

      1690       1700       1710       1720       1730       1740 
GNYNNNSLDD NLRPDRKLAG DSMQLGAAWK LPESSEPGCF LVGGKPSSCQ ENSMADAWNK 

      1750       1760       1770       1780       1790       1800 
NCAILINPQG PFSQCHQVVP PQSSFASCVH GQCGTKGDTT ALCRSLQAYA SLCAQAGQAP 

      1810       1820       1830       1840       1850       1860 
AWRNRTFCPM RCPPGSSYSP CSSPCPDTCS SINNPRDCPK ALPCAESCEC QKGHILSGTS 

      1870       1880       1890       1900       1910       1920 
CVPLGQCGCT DPAGSYHPVG ERWYTENTCT RLCTCSVHNN ITCFQSTCKP NQICWALDGL 

      1930       1940       1950       1960       1970       1980 
LRCRASGVGV CQLPGESHYV SFDGSNHSIP DACTLVLVKV CHPAMALPFF KISAKHEKEE 

      1990       2000       2010       2020       2030       2040 
GGTEAFRLHE VYIDIYDAQV TLQKGHRVLI NSKQVTLPAI SQIPGVSVKS SSIYSIVNIK 

      2050       2060       2070       2080       2090       2100 
IGVQVKFDGN HLLEIEIPTT YYGKVCGMCG NFNDEEEDEL MMPSDEVANS DSEFVNSWKD 

      2110       2120       2130       2140       2150       2160 
KDIDPSCQSL LVDEQQIPAE QQENPSGNCR AADLRRAREK CEAALRAPVW AQCASRIDLT 

      2170       2180       2190       2200       2210       2220 
PFLVDCANTL CEFGGLYQAL CQALQAFGAT CQSQGLKPPL WRNSSFCPLE CPAYSSYTNC 

      2230       2240       2250       2260       2270       2280 
LPSCSPSCWD LDGRCEGAKV PSACAEGCIC QPGYVLSEDK CVPRSQCGCK DAHGGSIPLG 

      2290       2300       2310       2320       2330       2340 
KSWVSSGCTE KCVCTGGAIQ CGDFRCPSGS HCQLTSDNSN SNCVSDKSEQ CSVYGDPRYL 

      2350       2360       2370       2380       2390       2400 
TFDGFSYRLQ GRMTYVLIKT VDVLPEGVEP LLVEGRNKMD PPRSSIFLQE VITTVYGYKV 

      2410       2420       2430       2440       2450       2460 
QLQAGLELVV NNQKMAVPYR PNEHLRVTLW GQRLYLVTDF ELVVSFGGRK NAVISLPSMY 

      2470       2480       2490       2500       2510       2520 
EGLVSGLCGN YDKNRKNDMM LPSGALTQNL NTFGNSWEVK TEDALLRFPR AIPAEEEGQG 

      2530       2540       2550       2560       2570       2580 
AELGLRTGLQ VSECSPEQLA SNSTQACRVL ADPQGPFAAC HQTVAPEPFQ EHCVLDLCSA 

      2590       2600       2610       2620       2630       2640 
QDPREQEELR CQVLSGHGVS SRYHISELYD TLPSILCQPG RPRGLRGPLR GRLRQHPRLC 

      2650       2660       2670       2680       2690       2700 
LQWHPEPPLA DCGCTSNGIY YQLGSSFLTE DCSQRCTCAS SRILLCEPFS CRAGEVCTLG 

      2710       2720       2730       2740       2750       2760 
NHTQGCFPES PCLQNPCQND GQCREQGATF TCECEVGYGG GLCMEPRDAP PPRKPASNLV 

      2770       2780       2790       2800       2810 
AVLLGLLVPV VVVLLAVTRE CIYRTRRKRE KTQEGDRLAR LVDTDTVLDC AC 

« Hide

Isoform 1 [UniParc].

Checksum: 74016809A5DF2331
Show »

FASTA2,724295,261
Isoform 2 [UniParc].

Checksum: 7E12C3343BFD408C
Show »

FASTA2,689291,356
Isoform 4 [UniParc].

Checksum: 1ABB2256CC5A2BA3
Show »

FASTA2,624284,848
Isoform 5 [UniParc].

Checksum: 6B97B524C67AABF4
Show »

FASTA2,601282,431
Isoform 6 [UniParc].

Checksum: 142E9CBF3D404EC3
Show »

FASTA2,721295,509
Isoform 7 [UniParc].

Checksum: C31893BFC621EF6C
Show »

FASTA2,866311,094

References

« Hide 'large scale' references
[1]"Multiple intra-species variants of human zonadhesin."
Cheung T.L., Wassler M.J., Cornwall G.A., Hardy D.M.
Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6).
Tissue: Testis.
[2]"Molecular population genetics of the gene encoding the human fertilization protein zonadhesin reveals rapid adaptive evolution."
Gasper J., Swanson W.J.
Am. J. Hum. Genet. 79:820-830(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HIS-430; LEU-1969; THR-2035 AND PRO-2111.
[3]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"Large-scale sequencing of two regions in human chromosome 7q22: analysis of 650 kb of genomic sequence around the EPO and CUTL1 loci reveals 17 genes."
Gloeckner G., Scherer S., Schattevoy R., Boright A.P., Weber J., Tsui L.-C., Rosenthal A.
Genome Res. 8:1060-1073(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HIS-430; LEU-1969; MET-1995; THR-2035 AND PRO-2111.
[6]"Comparative analysis of the gene-dense ACHE/TFR2 region on human chromosome 7q22 with the orthologous region on mouse chromosome 5."
Wilson M.D., Riemer C., Martindale D.W., Schnupf P., Boright A.P., Cheung T.L., Hardy D.M., Schwartz S., Scherer S.W., Tsui L.-C., Miller W., Koop B.F.
Nucleic Acids Res. 29:1352-1365(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1810-2812 (ISOFORM 1), VARIANTS LEU-1969; THR-2035 AND PRO-2111.
[7]"Chromosome localization of the mouse zonadhesin gene and the human zonadhesin gene (ZAN)."
Gao Z., Harumi T., Garbers D.L.
Genomics 41:119-122(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 2375-2683 (ISOFORM 7).
Tissue: Testis.
[8]"An unappreciated role for RNA surveillance."
Hillman R.T., Green R.E., Brenner S.E.
Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF332975 mRNA. Translation: AAK01431.1.
AF332976 mRNA. Translation: AAK01432.1.
AF332977 mRNA. Translation: AAK01433.1.
AF332978 mRNA. Translation: AAK01434.1.
AF332979 mRNA. Translation: AAK01435.1.
AF332980 mRNA. Translation: AAK01436.1.
EF025894 Genomic DNA. Translation: ABJ98522.1.
AY046055 Genomic DNA. Translation: AAL04410.1.
AY046055 Genomic DNA. Translation: AAL04411.1.
AY046055 Genomic DNA. Translation: AAL04412.1.
AY046055 Genomic DNA. Translation: AAL04413.1.
AY046055 Genomic DNA. Translation: AAL04414.1.
AY046055 Genomic DNA. Translation: AAL04415.1.
AC009488 Genomic DNA. No translation available.
AC011895 Genomic DNA. No translation available.
CH471091 Genomic DNA. Translation: EAW76487.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76488.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76489.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76490.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76491.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76492.1. Sequence problems.
AF053356 Genomic DNA. Translation: AAC78790.1. Sequence problems.
AF312032 Genomic DNA. Translation: AAK21011.1.
U83191 mRNA. Translation: AAC51208.1.
RefSeqNP_003377.1. NM_003386.1.
NP_775082.1. NM_173059.1.
UniGeneHs.307004.

3D structure databases

ProteinModelPortalQ9Y493.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

MINTMINT-4658080.

PTM databases

PhosphoSiteQ9Y493.

Proteomic databases

PRIDEQ9Y493.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000348028; ENSP00000423579; ENSG00000146839.
ENST00000349350; ENSP00000422387; ENSG00000146839.
ENST00000421100; ENSP00000425454; ENSG00000146839.
ENST00000427578; ENSP00000425200; ENSG00000146839.
ENST00000443370; ENSP00000421245; ENSG00000146839.
ENST00000449052; ENSP00000422208; ENSG00000146839.
GeneID7455.
KEGGhsa:7455.
UCSCuc003uwj.3. human. [Q9Y493-1]
uc003uwk.3. human. [Q9Y493-6]

Organism-specific databases

CTD7455.
GeneCardsGC07P100333.
HGNCHGNC:12857. ZAN.
MIM602372. gene.
neXtProtNX_Q9Y493.
PharmGKBPA37446.
GenAtlasSearch...

Phylogenomic databases

HOVERGENHBG000375.
InParanoidQ9Y493.
PhylomeDBQ9Y493.

Gene expression databases

ArrayExpressQ9Y493.
BgeeQ9Y493.
GenevestigatorQ9Y493.

Family and domain databases

InterProIPR008985. ConA-like_lec_gl_sf.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR000998. MAM_dom.
IPR002919. TIL_dom.
IPR025615. TILa_dom.
IPR014853. Unchr_dom_Cys-rich.
IPR001007. VWF_C.
IPR001846. VWF_type-D.
[Graphical view]
PfamPF08742. C8. 4 hits.
PF00008. EGF. 1 hit.
PF00629. MAM. 3 hits.
PF01826. TIL. 4 hits.
PF12714. TILa. 5 hits.
PF00094. VWD. 4 hits.
[Graphical view]
SMARTSM00832. C8. 4 hits.
SM00181. EGF. 1 hit.
SM00137. MAM. 3 hits.
SM00214. VWC. 3 hits.
SM00216. VWD. 4 hits.
[Graphical view]
SUPFAMSSF49899. SSF49899. 3 hits.
SSF57567. SSF57567. 4 hits.
PROSITEPS00022. EGF_1. 1 hit.
PS01186. EGF_2. 4 hits.
PS50026. EGF_3. 1 hit.
PS00740. MAM_1. 1 hit.
PS50060. MAM_2. 3 hits.
PS51233. VWFD. 4 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi7455.
NextBio29192.
PROQ9Y493.
SOURCESearch...

Entry information

Entry nameZAN_HUMAN
AccessionPrimary (citable) accession number: Q9Y493
Secondary accession number(s): A0FKC8 expand/collapse secondary AC list , D6W5W4, O00218, Q96L85, Q96L86, Q96L87, Q96L88, Q96L89, Q96L90, Q9BXN9, Q9BZ83, Q9BZ84, Q9BZ85, Q9BZ86, Q9BZ87, Q9BZ88
Entry history
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: March 8, 2011
Last modified: April 16, 2014
This is version 123 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM