SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Y493

- ZAN_HUMAN

UniProt

Q9Y493 - ZAN_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Zonadhesin
Gene
ZAN
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Binds in a species-specific manner to the zona pellucida of the egg. May be involved in gamete recognition and/or signaling.

GO - Biological processi

  1. binding of sperm to zona pellucida Source: UniProtKB
  2. single organismal cell-cell adhesion Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Zonadhesin
Gene namesi
Name:ZAN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:12857. ZAN.

Subcellular locationi

Cell membrane; Single-pass type I membrane protein
Note: Exclusively on the apical region of the sperm head By similarity.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini18 – 27572740Extracellular Reviewed prediction
Add
BLAST
Transmembranei2758 – 277821Helical; Reviewed prediction
Add
BLAST
Topological domaini2779 – 281234Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37446.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1717 Reviewed prediction
Add
BLAST
Chaini18 – 28122795Zonadhesin
PRO_0000007783Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi333 – 3331N-linked (GlcNAc...) Reviewed prediction
Glycosylationi493 – 4931N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1112 – 11121N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1188 – 11881N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1685 – 16851N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1804 – 18041N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1900 – 19001N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1946 – 19461N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2203 – 22031N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2542 – 25421N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2701 – 27011N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi2712 ↔ 2723 By similarity
Disulfide bondi2717 ↔ 2732 By similarity
Disulfide bondi2734 ↔ 2743 By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiQ9Y493.

PTM databases

PhosphoSiteiQ9Y493.

Expressioni

Tissue specificityi

In testis, primarily in haploid spermatids.

Gene expression databases

ArrayExpressiQ9Y493.
BgeeiQ9Y493.
GenevestigatoriQ9Y493.

Interactioni

Subunit structurei

Probably forms covalent oligomers.

Protein-protein interaction databases

MINTiMINT-4658080.

Structurei

3D structure databases

ProteinModelPortaliQ9Y493.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini39 – 204166MAM 1
Add
BLAST
Domaini209 – 368160MAM 2
Add
BLAST
Domaini371 – 536166MAM 3
Add
BLAST
Domaini1044 – 109350TIL 1
Add
BLAST
Domaini1103 – 114846VWFC 1
Add
BLAST
Domaini1155 – 1371217VWFD 1
Add
BLAST
Domaini1426 – 147954TIL 2
Add
BLAST
Domaini1480 – 153556VWFC 2
Add
BLAST
Domaini1541 – 1758218VWFD 2
Add
BLAST
Domaini1812 – 186756TIL 3
Add
BLAST
Domaini1868 – 192457VWFC 3
Add
BLAST
Domaini1930 – 2144215VWFD 3
Add
BLAST
Domaini2211 – 226757TIL 4
Add
BLAST
Domaini2268 – 232962VWFC 4
Add
BLAST
Domaini2330 – 2537208VWFD 4
Add
BLAST
Domaini2652 – 2797146VWFC 5
Add
BLAST
Domaini2708 – 274437EGF-like
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni573 – 104146966 X heptapeptide repeats (approximate) (mucin-like domain)
Add
BLAST

Domaini

The MAM domains probably mediate sperm adhesion to the zona pellucida.
During sperm migration through the reproductive tracts, the mucin-like domain might inhibit inappropriate trapping of spermatozoa or promoting adhesion to the oviductal isthmus.
The VWFD domain 2 may mediate covalent oligomerization By similarity.

Sequence similaritiesi

Contains 1 EGF-like domain.
Contains 3 MAM domains.
Contains 5 VWFC domains.
Contains 4 VWFD domains.

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

HOVERGENiHBG000375.
InParanoidiQ9Y493.
PhylomeDBiQ9Y493.

Family and domain databases

InterProiIPR008985. ConA-like_lec_gl_sf.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR000998. MAM_dom.
IPR002919. TIL_dom.
IPR025615. TILa_dom.
IPR014853. Unchr_dom_Cys-rich.
IPR001007. VWF_C.
IPR001846. VWF_type-D.
[Graphical view]
PfamiPF08742. C8. 4 hits.
PF00008. EGF. 1 hit.
PF00629. MAM. 3 hits.
PF01826. TIL. 4 hits.
PF12714. TILa. 5 hits.
PF00094. VWD. 4 hits.
[Graphical view]
SMARTiSM00832. C8. 4 hits.
SM00181. EGF. 1 hit.
SM00137. MAM. 3 hits.
SM00214. VWC. 3 hits.
SM00216. VWD. 4 hits.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 3 hits.
SSF57567. SSF57567. 4 hits.
PROSITEiPS00022. EGF_1. 1 hit.
PS01186. EGF_2. 4 hits.
PS50026. EGF_3. 1 hit.
PS00740. MAM_1. 1 hit.
PS50060. MAM_2. 3 hits.
PS51233. VWFD. 4 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 3 (identifier: Q9Y493-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVPPVWTLLL LVGAALFRKE KPPDQKLVVR SSRDNYVLTQ CDFEDDAKPL     50
CDWSQVSADD EDWVRASGPS PTGSTGAPGG YPNGEGSYLH MESNSFHRGG 100
VARLLSPDLW EQGPLCVHFA HHMFGLSWGA QLRLLLLSGE EGRRPDVLWK 150
HWNTQRPSWM LTTVTVPAGF TLPTRLMFEG TRGSTAYLDI ALDALSIRRG 200
SCNRVCMMQT CSFDIPNDLC DWTWIPTASG AKWTQKKGSS GKPGVGPDGD 250
FSSPGSGCYM LLDPKNARPG QKAVLLSPVS LSSGCLSFSF HYILRGQSPG 300
AALHIYASVL GSIRKHTLFS GQPGPNWQAV SVNYTAVGRI QFAVVGVFGK 350
TPEPAVAVDA TSIAPCGEGF PQCDFEDNAH PFCDWVQTSG DGGHWALGHK 400
NGPVHGMGPA GGFPNAGGHY IYLEADEFSQ AGQSVRLVSR PFCAPGDICV 450
EFAYHMYGLG EGTMLELLLG SPAGSPPIPL WKRVGSQRPY WQNTSVTVPS 500
GHQQPMQLIF KGIQGSNTAS VVAMGFILIN PGTCPVKVLP ELPPVSPVSS 550
TGPSETTGLT ENPTISTKKP TVSIEKPSVT TEKPTVPKEK PTIPTEKPTI 600
STEKPTIPSE KPNMPSEKPT IPSEKPTILT EKPTIPSEKP TIPSEKPTIS 650
TEKPTVPTEE PTTPTEETTT SMEEPVIPTE KPSIPTEKPS IPTEKPTISM 700
EETIISTEKP TISPEKPTIP TEKPTIPTEK STISPEKPTT PTEKPTIPTE 750
KPTISPEKPT TPTEKPTISP EKLTIPTEKP TIPTEKPTIP TEKPTISTEE 800
PTTPTEETTI STEKPSIPME KPTLPTEETT TSVEETTIST EKLTIPMEKP 850
TISTEKPTIP TEKPTISPEK LTIPTEKLTI PTEKPTIPIE ETTISTEKLT 900
IPTEKPTISP EKPTISTEKP TIPTEKPTIP TEETTISTEK LTIPTEKPTI 950
SPEKLTIPTE KPTISTEKPT IPTEKLTIPT EKPTIPTEKP TIPTEKLTAL 1000
RPPHPSPTAT GLAALVMSPH APSTPMTSVI LGTTTTSRSS TERCPPNARY 1050
ESCACPASCK SPRPSCGPLC REGCVCNPGF LFSDNHCIQA SSCNCFYNND 1100
YYEPGAEWFS PNCTEHCRCW PGSRVECQIS QCGTHTVCQL KNGQYGCHPY 1150
AGTATCLVYG DPHYVTFDGR HFGFMGKCTY ILAQPCGNST DPFFRVTAKN 1200
EEQGQEGVSC LSKVYVTLPE STVTLLKGRR TLVGGQQVTL PAIPSKGVFL 1250
GASGRFVELQ TEFGLRVRWD GDQQLYVTVS STYSGKLCGL CGNYDGNSDN 1300
DHLKLDGSPA GDKEELGNSW QTDQDEDQEC QKYQVVNSPS CDSSLQSSMS 1350
GPGFCGRLVD THGPFETCLL HVKAASFFDS CMLDMCGFQG LQHLLCTHMS 1400
TMTTTCQDAG HAVKPWREPH FCPMACPPNS KYSLCAKPCP DTCHSGFSGM 1450
FCSDRCVEAC ECNPGFVLSG LECIPRSQCG CLHPAGSYFK VGERWYKPGC 1500
KELCVCESNN RIRCQPWRCR AQEFCGQQDG IYGCHAQGAA TCTASGDPHY 1550
LTFDGALHHF MGTCTYVLTR PCWSRSQDSY FVVSATNENR GGILEVSYIK 1600
AVHVTVFDLS ISLLRGCKVM LNGHRVALPV WLAQGRVTIR LSSNLVLLYT 1650
NFGLQVRYDG SHLVEVTVPS SYGGQLCGLC GNYNNNSLDD NLRPDRKLAG 1700
DSMQLGAAWK LPESSEPGCF LVGGKPSSCQ ENSMADAWNK NCAILINPQG 1750
PFSQCHQVVP PQSSFASCVH GQCGTKGDTT ALCRSLQAYA SLCAQAGQAP 1800
AWRNRTFCPM RCPPGSSYSP CSSPCPDTCS SINNPRDCPK ALPCAESCEC 1850
QKGHILSGTS CVPLGQCGCT DPAGSYHPVG ERWYTENTCT RLCTCSVHNN 1900
ITCFQSTCKP NQICWALDGL LRCRASGVGV CQLPGESHYV SFDGSNHSIP 1950
DACTLVLVKV CHPAMALPFF KISAKHEKEE GGTEAFRLHE VYIDIYDAQV 2000
TLQKGHRVLI NSKQVTLPAI SQIPGVSVKS SSIYSIVNIK IGVQVKFDGN 2050
HLLEIEIPTT YYGKVCGMCG NFNDEEEDEL MMPSDEVANS DSEFVNSWKD 2100
KDIDPSCQSL LVDEQQIPAE QQENPSGNCR AADLRRAREK CEAALRAPVW 2150
AQCASRIDLT PFLVDCANTL CEFGGLYQAL CQALQAFGAT CQSQGLKPPL 2200
WRNSSFCPLE CPAYSSYTNC LPSCSPSCWD LDGRCEGAKV PSACAEGCIC 2250
QPGYVLSEDK CVPRSQCGCK DAHGGSIPLG KSWVSSGCTE KCVCTGGAIQ 2300
CGDFRCPSGS HCQLTSDNSN SNCVSDKSEQ CSVYGDPRYL TFDGFSYRLQ 2350
GRMTYVLIKT VDVLPEGVEP LLVEGRNKMD PPRSSIFLQE VITTVYGYKV 2400
QLQAGLELVV NNQKMAVPYR PNEHLRVTLW GQRLYLVTDF ELVVSFGGRK 2450
NAVISLPSMY EGLVSGLCGN YDKNRKNDMM LPSGALTQNL NTFGNSWEVK 2500
TEDALLRFPR AIPAEEEGQG AELGLRTGLQ VSECSPEQLA SNSTQACRVL 2550
ADPQGPFAAC HQTVAPEPFQ EHCVLDLCSA QDPREQEELR CQVLSGHGVS 2600
SRYHISELYD TLPSILCQPG RPRGLRGPLR GRLRQHPRLC LQWHPEPPLA 2650
DCGCTSNGIY YQLGSSFLTE DCSQRCTCAS SRILLCEPFS CRAGEVCTLG 2700
NHTQGCFPES PCLQNPCQND GQCREQGATF TCECEVGYGG GLCMEPRDAP 2750
PPRKPASNLV AVLLGLLVPV VVVLLAVTRE CIYRTRRKRE KTQEGDRLAR 2800
LVDTDTVLDC AC 2812
Length:2,812
Mass (Da):305,663
Last modified:March 8, 2011 - v4
Checksum:i912FBE459AFC3302
GO
Isoform 1 (identifier: Q9Y493-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2724: HGVSSRYHIS...NPCQNDGQCR → YAILCQEAGA...PFLAGQQLSD
     2725-2812: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:2,724
Mass (Da):295,261
Checksum:i74016809A5DF2331
GO
Isoform 2 (identifier: Q9Y493-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2689: HGVSSRYHIS...SSRILLCEPF → YAILCQEAGA...ASTTSWAAAF
     2690-2812: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:2,689
Mass (Da):291,356
Checksum:i7E12C3343BFD408C
GO
Isoform 4 (identifier: Q9Y493-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2624: HGVSSRYHISELYDTLPSILCQPGRPRG → YAILCQEAGAALAGWRDRTLCAGQQLSD
     2625-2812: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:2,624
Mass (Da):284,848
Checksum:i1ABB2256CC5A2BA3
GO
Isoform 5 (identifier: Q9Y493-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2601: HGVSS → WAAAF
     2602-2812: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:2,601
Mass (Da):282,431
Checksum:i6B97B524C67AABF4
GO
Isoform 6 (identifier: Q9Y493-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2617: HGVSSRYHISELYDTLPSILC → YAILCQEAGAALAGWRDRTLC
     2618-2708: Missing.

Show »
Length:2,721
Mass (Da):295,509
Checksum:i142E9CBF3D404EC3
GO
Isoform 7 (identifier: Q9Y493-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2597-2636: HGVSSRYHIS...GPLRGRLRQH → YAILCQEAGA...EGPCVEGCAD
     2663-2666: LGSS → VRAGSRRPWGAEAPRRARPGMELERLLLALPFLAGQQ

Show »
Length:2,866
Mass (Da):311,094
Checksum:iC31893BFC621EF6C
GO

Sequence cautioni

The sequence AAC78790.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence EAW76487.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence EAW76488.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence EAW76489.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence EAW76490.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence EAW76491.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence EAW76492.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti16 – 161L → F.
Corresponds to variant rs12673246 [ dbSNP | Ensembl ].
VAR_064584
Natural varianti113 – 1131G → A.
Corresponds to variant rs34828430 [ dbSNP | Ensembl ].
VAR_061162
Natural varianti412 – 4121G → S.
Corresponds to variant rs17162408 [ dbSNP | Ensembl ].
VAR_055785
Natural varianti430 – 4301Q → H.2 Publications
Corresponds to variant rs221833 [ dbSNP | Ensembl ].
VAR_064585
Natural varianti690 – 6901S → T.
Corresponds to variant rs13241461 [ dbSNP | Ensembl ].
VAR_055786
Natural varianti1012 – 10121L → R.
Corresponds to variant rs6942733 [ dbSNP | Ensembl ].
VAR_055787
Natural varianti1096 – 10961F → C.
Corresponds to variant rs221823 [ dbSNP | Ensembl ].
VAR_055788
Natural varianti1375 – 13751A → T.
Corresponds to variant rs2293767 [ dbSNP | Ensembl ].
VAR_055789
Natural varianti1674 – 16741G → C.
Corresponds to variant rs10953303 [ dbSNP | Ensembl ].
VAR_055790
Natural varianti1698 – 16981L → P.
Corresponds to variant rs10247980 [ dbSNP | Ensembl ].
VAR_055791
Natural varianti1742 – 17421C → R.
Corresponds to variant rs17147735 [ dbSNP | Ensembl ].
VAR_055792
Natural varianti1878 – 18781P → S.
Corresponds to variant rs314298 [ dbSNP | Ensembl ].
VAR_055793
Natural varianti1903 – 19031C → Y.
Corresponds to variant rs12673041 [ dbSNP | Ensembl ].
VAR_055794
Natural varianti1922 – 19221R → C.
Corresponds to variant rs314299 [ dbSNP | Ensembl ].
VAR_064586
Natural varianti1969 – 19691F → L.3 Publications
Corresponds to variant rs542137 [ dbSNP | Ensembl ].
VAR_064587
Natural varianti1995 – 19951I → M.1 Publication
Corresponds to variant rs541275 [ dbSNP | Ensembl ].
VAR_059278
Natural varianti2035 – 20351S → T.3 Publications
Corresponds to variant rs539445 [ dbSNP | Ensembl ].
VAR_064588
Natural varianti2073 – 20731N → S.
Corresponds to variant rs314300 [ dbSNP | Ensembl ].
VAR_059279
Natural varianti2111 – 21111L → P.3 Publications
Corresponds to variant rs531503 [ dbSNP | Ensembl ].
VAR_064589
Natural varianti2334 – 23341Y → S.
Corresponds to variant rs60783739 [ dbSNP | Ensembl ].
VAR_061163
Natural varianti2349 – 23491L → F.
Corresponds to variant rs59541653 [ dbSNP | Ensembl ].
VAR_061164
Natural varianti2527 – 25271T → M.
Corresponds to variant rs3847059 [ dbSNP | Ensembl ].
VAR_059280
Natural varianti2643 – 26431W → R.
Corresponds to variant rs314339 [ dbSNP | Ensembl ].
VAR_059281

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2597 – 2724128HGVSS…DGQCR → YAILCQEAGAALAGWRDRTL CAMECPAGTIYQSCMTPCPA SCANLADPGDCEGPCVEGCA SIPGYAYSGTQSLPWLTVAA PAMASTTRSELAAGGPGEQR RQGEPDQGWNWNVSSWPFPF LAGQQLSD in isoform 1.
VSP_001430Add
BLAST
Alternative sequencei2597 – 268993HGVSS…LCEPF → YAILCQEAGAALAGWRDRTL CAMECPAGTIYQSCMTPCPA SCANLADPGDCEGPCVEGCA SIPGYAYSGTQSLPWLTVAA PAMASTTSWAAAF in isoform 2.
VSP_001428Add
BLAST
Alternative sequencei2597 – 263640HGVSS…RLRQH → YAILCQEAGAALAGWRDRTL CAMECPAGTIYQSCMTPCPA SCANLADPGDCEGPCVEGCA D in isoform 7.
VSP_001426Add
BLAST
Alternative sequencei2597 – 262428HGVSS…GRPRG → YAILCQEAGAALAGWRDRTL CAGQQLSD in isoform 4.
VSP_001424Add
BLAST
Alternative sequencei2597 – 261721HGVSS…PSILC → YAILCQEAGAALAGWRDRTL C in isoform 6.
VSP_001422Add
BLAST
Alternative sequencei2597 – 26015HGVSS → WAAAF in isoform 5.
VSP_001420
Alternative sequencei2602 – 2812211Missing in isoform 5.
VSP_001421Add
BLAST
Alternative sequencei2618 – 270891Missing in isoform 6.
VSP_001423Add
BLAST
Alternative sequencei2625 – 2812188Missing in isoform 4.
VSP_001425Add
BLAST
Alternative sequencei2663 – 26664LGSS → VRAGSRRPWGAEAPRRARPG MELERLLLALPFLAGQQ in isoform 7.
VSP_001427
Alternative sequencei2690 – 2812123Missing in isoform 2.
VSP_001429Add
BLAST
Alternative sequencei2725 – 281288Missing in isoform 1.
VSP_001431Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1922 – 19221R → H in AAL04410. 1 Publication
Sequence conflicti1922 – 19221R → H in AAL04411. 1 Publication
Sequence conflicti1922 – 19221R → H in AAL04412. 1 Publication
Sequence conflicti1922 – 19221R → H in AAL04413. 1 Publication
Sequence conflicti1922 – 19221R → H in AAL04414. 1 Publication
Sequence conflicti1922 – 19221R → H in AAL04415. 1 Publication
Sequence conflicti1922 – 19221R → H in ABJ98522. 1 Publication
Sequence conflicti1922 – 19221R → H in AAC78790. 1 Publication
Sequence conflicti1922 – 19221R → H in AAK21011. 1 Publication
Sequence conflicti2430 – 24301W → R in AAL04410. 1 Publication
Sequence conflicti2430 – 24301W → R in AAL04411. 1 Publication
Sequence conflicti2430 – 24301W → R in AAL04412. 1 Publication
Sequence conflicti2430 – 24301W → R in AAL04413. 1 Publication
Sequence conflicti2430 – 24301W → R in AAL04414. 1 Publication
Sequence conflicti2430 – 24301W → R in AAL04415. 1 Publication
Sequence conflicti2430 – 24301W → R in ABJ98522. 1 Publication
Sequence conflicti2430 – 24301W → R in AAK21011. 1 Publication
Sequence conflicti2430 – 24301W → R in AAC51208. 1 Publication
Sequence conflicti2555 – 25551G → A in AAC51208. 1 Publication
Sequence conflicti2565 – 25651A → P in AAC51208. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF332975 mRNA. Translation: AAK01431.1.
AF332976 mRNA. Translation: AAK01432.1.
AF332977 mRNA. Translation: AAK01433.1.
AF332978 mRNA. Translation: AAK01434.1.
AF332979 mRNA. Translation: AAK01435.1.
AF332980 mRNA. Translation: AAK01436.1.
EF025894 Genomic DNA. Translation: ABJ98522.1.
AY046055 Genomic DNA. Translation: AAL04410.1.
AY046055 Genomic DNA. Translation: AAL04411.1.
AY046055 Genomic DNA. Translation: AAL04412.1.
AY046055 Genomic DNA. Translation: AAL04413.1.
AY046055 Genomic DNA. Translation: AAL04414.1.
AY046055 Genomic DNA. Translation: AAL04415.1.
AC009488 Genomic DNA. No translation available.
AC011895 Genomic DNA. No translation available.
CH471091 Genomic DNA. Translation: EAW76487.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76488.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76489.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76490.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76491.1. Sequence problems.
CH471091 Genomic DNA. Translation: EAW76492.1. Sequence problems.
AF053356 Genomic DNA. Translation: AAC78790.1. Sequence problems.
AF312032 Genomic DNA. Translation: AAK21011.1.
U83191 mRNA. Translation: AAC51208.1.
RefSeqiNP_003377.2. NM_003386.2.
NP_775082.2. NM_173059.2.
UniGeneiHs.307004.

Genome annotation databases

EnsembliENST00000348028; ENSP00000423579; ENSG00000146839.
ENST00000349350; ENSP00000422387; ENSG00000146839.
ENST00000421100; ENSP00000425454; ENSG00000146839.
ENST00000427578; ENSP00000425200; ENSG00000146839.
ENST00000443370; ENSP00000421245; ENSG00000146839.
ENST00000449052; ENSP00000422208; ENSG00000146839.
GeneIDi7455.
KEGGihsa:7455.
UCSCiuc003uwj.3. human. [Q9Y493-1]
uc003uwk.3. human. [Q9Y493-6]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF332975 mRNA. Translation: AAK01431.1 .
AF332976 mRNA. Translation: AAK01432.1 .
AF332977 mRNA. Translation: AAK01433.1 .
AF332978 mRNA. Translation: AAK01434.1 .
AF332979 mRNA. Translation: AAK01435.1 .
AF332980 mRNA. Translation: AAK01436.1 .
EF025894 Genomic DNA. Translation: ABJ98522.1 .
AY046055 Genomic DNA. Translation: AAL04410.1 .
AY046055 Genomic DNA. Translation: AAL04411.1 .
AY046055 Genomic DNA. Translation: AAL04412.1 .
AY046055 Genomic DNA. Translation: AAL04413.1 .
AY046055 Genomic DNA. Translation: AAL04414.1 .
AY046055 Genomic DNA. Translation: AAL04415.1 .
AC009488 Genomic DNA. No translation available.
AC011895 Genomic DNA. No translation available.
CH471091 Genomic DNA. Translation: EAW76487.1 . Sequence problems.
CH471091 Genomic DNA. Translation: EAW76488.1 . Sequence problems.
CH471091 Genomic DNA. Translation: EAW76489.1 . Sequence problems.
CH471091 Genomic DNA. Translation: EAW76490.1 . Sequence problems.
CH471091 Genomic DNA. Translation: EAW76491.1 . Sequence problems.
CH471091 Genomic DNA. Translation: EAW76492.1 . Sequence problems.
AF053356 Genomic DNA. Translation: AAC78790.1 . Sequence problems.
AF312032 Genomic DNA. Translation: AAK21011.1 .
U83191 mRNA. Translation: AAC51208.1 .
RefSeqi NP_003377.2. NM_003386.2.
NP_775082.2. NM_173059.2.
UniGenei Hs.307004.

3D structure databases

ProteinModelPortali Q9Y493.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

MINTi MINT-4658080.

PTM databases

PhosphoSitei Q9Y493.

Proteomic databases

PRIDEi Q9Y493.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000348028 ; ENSP00000423579 ; ENSG00000146839 .
ENST00000349350 ; ENSP00000422387 ; ENSG00000146839 .
ENST00000421100 ; ENSP00000425454 ; ENSG00000146839 .
ENST00000427578 ; ENSP00000425200 ; ENSG00000146839 .
ENST00000443370 ; ENSP00000421245 ; ENSG00000146839 .
ENST00000449052 ; ENSP00000422208 ; ENSG00000146839 .
GeneIDi 7455.
KEGGi hsa:7455.
UCSCi uc003uwj.3. human. [Q9Y493-1 ]
uc003uwk.3. human. [Q9Y493-6 ]

Organism-specific databases

CTDi 7455.
GeneCardsi GC07P100333.
HGNCi HGNC:12857. ZAN.
MIMi 602372. gene.
neXtProti NX_Q9Y493.
PharmGKBi PA37446.
GenAtlasi Search...

Phylogenomic databases

HOVERGENi HBG000375.
InParanoidi Q9Y493.
PhylomeDBi Q9Y493.

Miscellaneous databases

GenomeRNAii 7455.
NextBioi 29192.
PROi Q9Y493.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9Y493.
Bgeei Q9Y493.
Genevestigatori Q9Y493.

Family and domain databases

InterProi IPR008985. ConA-like_lec_gl_sf.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR000998. MAM_dom.
IPR002919. TIL_dom.
IPR025615. TILa_dom.
IPR014853. Unchr_dom_Cys-rich.
IPR001007. VWF_C.
IPR001846. VWF_type-D.
[Graphical view ]
Pfami PF08742. C8. 4 hits.
PF00008. EGF. 1 hit.
PF00629. MAM. 3 hits.
PF01826. TIL. 4 hits.
PF12714. TILa. 5 hits.
PF00094. VWD. 4 hits.
[Graphical view ]
SMARTi SM00832. C8. 4 hits.
SM00181. EGF. 1 hit.
SM00137. MAM. 3 hits.
SM00214. VWC. 3 hits.
SM00216. VWD. 4 hits.
[Graphical view ]
SUPFAMi SSF49899. SSF49899. 3 hits.
SSF57567. SSF57567. 4 hits.
PROSITEi PS00022. EGF_1. 1 hit.
PS01186. EGF_2. 4 hits.
PS50026. EGF_3. 1 hit.
PS00740. MAM_1. 1 hit.
PS50060. MAM_2. 3 hits.
PS51233. VWFD. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Multiple intra-species variants of human zonadhesin."
    Cheung T.L., Wassler M.J., Cornwall G.A., Hardy D.M.
    Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6).
    Tissue: Testis.
  2. "Molecular population genetics of the gene encoding the human fertilization protein zonadhesin reveals rapid adaptive evolution."
    Gasper J., Swanson W.J.
    Am. J. Hum. Genet. 79:820-830(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HIS-430; LEU-1969; THR-2035 AND PRO-2111.
  3. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "Large-scale sequencing of two regions in human chromosome 7q22: analysis of 650 kb of genomic sequence around the EPO and CUTL1 loci reveals 17 genes."
    Gloeckner G., Scherer S., Schattevoy R., Boright A.P., Weber J., Tsui L.-C., Rosenthal A.
    Genome Res. 8:1060-1073(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HIS-430; LEU-1969; MET-1995; THR-2035 AND PRO-2111.
  6. "Comparative analysis of the gene-dense ACHE/TFR2 region on human chromosome 7q22 with the orthologous region on mouse chromosome 5."
    Wilson M.D., Riemer C., Martindale D.W., Schnupf P., Boright A.P., Cheung T.L., Hardy D.M., Schwartz S., Scherer S.W., Tsui L.-C., Miller W., Koop B.F.
    Nucleic Acids Res. 29:1352-1365(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1810-2812 (ISOFORM 1), VARIANTS LEU-1969; THR-2035 AND PRO-2111.
  7. "Chromosome localization of the mouse zonadhesin gene and the human zonadhesin gene (ZAN)."
    Gao Z., Harumi T., Garbers D.L.
    Genomics 41:119-122(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 2375-2683 (ISOFORM 7).
    Tissue: Testis.
  8. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).

Entry informationi

Entry nameiZAN_HUMAN
AccessioniPrimary (citable) accession number: Q9Y493
Secondary accession number(s): A0FKC8
, D6W5W4, O00218, Q96L85, Q96L86, Q96L87, Q96L88, Q96L89, Q96L90, Q9BXN9, Q9BZ83, Q9BZ84, Q9BZ85, Q9BZ86, Q9BZ87, Q9BZ88
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: March 8, 2011
Last modified: July 9, 2014
This is version 126 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi