Q9Y468 (LMBL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 120.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Lethal(3)malignant brain tumor-like protein 1 Short name=H-l(3)mbt Short name=H-l(3)mbt protein Short name=L(3)mbt-like Alternative name(s): L(3)mbt protein homolog L3MBTL1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 752 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Polycomb group (PcG) protein that specifically recognizes and binds mono- and dimethyllysine residues on target proteins, therey acting as a 'reader' of a network of post-translational modifications. PcG proteins maintain the transcriptionally repressive state of genes: acts as a chromatin compaction factor by recognizing and binding mono- and dimethylated histone H1b/HIST1H1E at 'Lys-26' (H1bK26me1 and H1bK26me2) and histone H4 at 'Lys-20' (H4K20me1 and H4K20me2), leading to condense chromatin and repress transcription. Recognizes and binds p53/TP53 monomethylated at 'Lys-382', leading to repress p53/TP53-target genes. Also recognizes and binds RB1/RB monomethylated at 'Lys-860'. Participates in the ETV6-mediated repression. Probably plays a role in cell proliferation. Overexpression induces multinucleated cells, suggesting that it is required to accomplish normal mitosis. Ref.9 Ref.10 Ref.11 Ref.16 |
| Subunit structure | Homodimer. Interacts with RB1/RB (when monomethylated at 'Lys-860'). Interacts with p53/TP53 (when monomethylated at 'Lys-382'). Interacts with CBX3, ETV6 and SETD8. Ref.7 Ref.9 Ref.10 Ref.11 Ref.16 |
| Subcellular location | Nucleus. Note: Excluded from the nucleolus. Does not colocalizes with the PcG protein BMI1, suggesting that these two proteins do not belong to the same complex. Ref.1 |
| Tissue specificity | Widely expressed. Expression is reduced in colorectal cancer cell line SW480 and promyelocytic leukemia cell line HL-60. Ref.1 |
| Developmental stage | In interphase cells, it is scattered throughout the nucleoplasm. In mitotic cells, it strongly associates with condensed chromosomes from the prophase to telophase. |
| Domain | The MBT repeat 2 specifically recognizes and binds monomethylated and dimethylated proteins. In contrast, it does not bind trimethylated proteins. The MBT repeat 1 does not bind methylated peptides but inserts a proline ring in a Pro-Ser-Ser/Thr sequence context. Ref.13 |
| Miscellaneous | The L3MBTL1 locus is imprinted. Paternal inherited gene is expressed, while the maternal inherited gene is silenced. |
| Sequence similarities | Contains 1 C2HC-type zinc finger. Contains 3 MBT repeats. Contains 1 SAM (sterile alpha motif) domain. |
| Sequence caution | The sequence CAI23042.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI42317.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence EAW75958.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence EAW75961.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence EAW75962.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| HIST1H1E | P10412 | 7 | EBI-1265089,EBI-358163 | |
| HIST1H4A | P62805 | 3 | EBI-1265089,EBI-302023 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 4 (identifier: Q9Y468-4) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 1 (identifier: Q9Y468-1) Also known as: mbt-I; The sequence of this isoform differs from the canonical sequence as follows: 709-752: MIDGEAFLLL...MFKNADDTLK → ARIVRVTHVS...KLSFASDSQY | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Natural variant | 759 | 1 | H → R DbSNP:rs6030948. | ||||||
| Isoform 2 (identifier: Q9Y468-2) Also known as: mbt-II; The sequence of this isoform differs from the canonical sequence as follows: 709-752: MIDGEAFLLLTQADIVKIMSVKLGPALKIYNAILMFKNADDTLK → VRCKCRVGDRAGVTVLKTAGSRCPPQRHFC | |||||||||
| Isoform 3 (identifier: Q9Y468-3) The sequence of this isoform differs from the canonical sequence as follows: 1-348: Missing. 709-752: MIDGEAFLLLTQADIVKIMSVKLGPALKIYNAILMFKNADDTLK → VRCKCRVGDRAGVTVLKTAGSRCPPQRHFC | |||||||||
| Isoform 5 (identifier: Q9Y468-5) The sequence of this isoform differs from the canonical sequence as follows: 1-30: MRRREGHGTDSEMGQGPVRESQSSDPPALQ → MHLVAGDSPG...AAPPPGGGLR 709-752: MIDGEAFLLL...MFKNADDTLK → ARIVRVTHVS...KLSFASDSQY | |||||||||
| Note: No experimental confirmation available. | |||||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 752 | 752 | Lethal(3)malignant brain tumor-like protein 1 | PRO_0000084452 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 206 – 306 | 101 | MBT 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 314 – 413 | 100 | MBT 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 422 – 517 | 96 | MBT 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 683 – 747 | 65 | SAM | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 552 – 578 | 27 | C2HC-type | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 379 – 386 | 8 | Interaction with monomethylated and dimethylated peptides | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 355 | 1 | Mediates recognition of monomethylated and dimethylated peptides | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 358 | 1 | positioned at the entrance of MBT 2 and is required for recognition of monomethylated and dimethylated peptides | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 348 | 348 | Missing in isoform 3. | VSP_003901 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 30 | 30 | MRRRE…PPALQ → MHLVAGDSPGSGPHLPATAF IIPASSATLGLPSSALDVSC FPREPIHVGAPEQVAGCEPV SATVLPQLSAGPASSSTSTV RLLEWTEAAAPPPGGGLR in isoform 5. | VSP_040719 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 709 – 752 | 44 | MIDGE…DDTLK → ARIVRVTHVSGKTLVWTVAQ LGDLVCSDHLQEGKGILETG VHSLLCSLPTHLLAKLSFAS DSQY in isoform 1 and isoform 5. | VSP_003903 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 709 – 752 | 44 | MIDGE…DDTLK → VRCKCRVGDRAGVTVLKTAG SRCPPQRHFC in isoform 2 and isoform 3. | VSP_003902 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 49 | 1 | S → T. Ref.5 Corresponds to variant rs17857202 [ dbSNP | Ensembl ]. | VAR_051097 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 479 | 1 | I → M. Corresponds to variant rs6017104 [ dbSNP | Ensembl ]. | VAR_051098 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 248 | 1 | D → N: Does not affect binding to monomethylated and dimethylated peptides. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 272 | 1 | F → A: Does not affect binding to monomethylated and dimethylated peptides. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 355 | 1 | D → A: Abolishes binding to monomethylated and dimethylated peptides. Ref.9 Ref.13 Ref.14 Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 355 | 1 | D → N: Strongly impairs binding to monomethylated and dimethylated peptides. Abolishes binding to p53/TP53 monomethylated at 'Lys-382'. Ref.9 Ref.13 Ref.14 Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 358 | 1 | N → A: Abolishes binding to monomethylated and dimethylated peptides. Ref.13 Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 358 | 1 | N → Q: Strongly impairs binding to monomethylated and dimethylated peptides. Abolishes binding to p53/TP53 monomethylated at 'Lys-382'. Ref.13 Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 363 | 1 | C → F or R: Strongly impairs binding to monomethylated and dimethylated peptides. Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 379 | 1 | F → A: Abolishes binding to monomethylated and dimethylated peptides. Abolishes binding to p53/TP53 monomethylated at 'Lys-382'. Ref.9 Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 382 | 1 | W → L: Abolishes binding to p53/TP53 monomethylated at 'Lys-382'. Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 386 | 1 | Y → L: Abolishes binding to p53/TP53 monomethylated at 'Lys-382'. Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 459 | 1 | D → N: Does not affect binding to monomethylated and dimethylated peptides. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 483 | 1 | F → A: Does not affect binding to monomethylated and dimethylated peptides. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 186 | 1 | T → A in BAG61241. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 305 | 1 | P → L in AAC69438. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 320 – 321 | 2 | LR → MC in AAC69438. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 332 | 1 | L → M in AAC69438. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 493 | 1 | W → R in BAG61241. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 595 | 1 | S → P in AAC69438. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 208 – 215 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 222 – 224 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 227 – 230 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 243 – 248 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 251 – 264 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 267 – 272 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 277 – 279 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 281 – 284 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 295 – 299 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 311 – 313 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 316 – 323 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 330 – 332 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 350 – 354 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 362 – 371 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 374 – 379 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 384 – 386 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 388 – 390 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 402 – 406 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 424 – 430 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 438 – 440 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 454 – 458 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 466 – 474 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 476 – 483 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 488 – 490 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 492 – 495 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 506 – 510 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A human homolog of Drosophila lethal(3)malignant brain tumor (l(3)mbt) protein associates with condensed mitotic chromosomes." Koga H., Matsui S., Hirota T., Takebayashi S., Okumura K., Saya H. Oncogene 18:3799-3809(1999) [PubMed: 10445843] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Uterus. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-49. Tissue: Brain. |
| [6] | "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:169-176(1998) [PubMed: 9734811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 215-752 (ISOFORM 4). Tissue: Brain. |
| [7] | "The human L(3)MBT Polycomb group protein is a transcriptional repressor and interacts physically and functionally with TEL (ETV6)." Boccuni P., MacGrogan D., Scandura J.M., Nimer S.D. J. Biol. Chem. 278:15412-15420(2003) [PubMed: 12588862] [Abstract] Cited for: INTERACTION WITH ETV6. |
| [8] | "Imprinting of the human L3MBTL gene, a polycomb family member located in a region of chromosome 20 deleted in human myeloid malignancies." Li J., Bench A.J., Vassiliou G.S., Fourouclas N., Ferguson-Smith A.C., Green A.R. Proc. Natl. Acad. Sci. U.S.A. 101:7341-7346(2004) [PubMed: 15123827] [Abstract] Cited for: IMPRINTING. |
| [9] | "L3MBTL1, a histone-methylation-dependent chromatin lock." Trojer P., Li G., Sims R.J. III, Vaquero A., Kalakonda N., Boccuni P., Lee D., Erdjument-Bromage H., Tempst P., Nimer S.D., Wang Y.H., Reinberg D. Cell 129:915-928(2007) [PubMed: 17540172] [Abstract] Cited for: FUNCTION, INTERACTION WITH CBX3 AND HISTONES, MUTAGENESIS OF ASP-248; PHE-272; ASP-355; PHE-379; ASP-459 AND PHE-483. |
| [10] | "Histone H4 lysine 20 monomethylation promotes transcriptional repression by L3MBTL1." Kalakonda N., Fischle W., Boccuni P., Gurvich N., Hoya-Arias R., Zhao X., Miyata Y., Macgrogan D., Zhang J., Sims J.K., Rice J.C., Nimer S.D. Oncogene 27:4293-4304(2008) [PubMed: 18408754] [Abstract] Cited for: FUNCTION, INTERACTION WITH SETD8. |
| [11] | "Methylation of the retinoblastoma tumor suppressor by SMYD2." Saddic L.A., West L.E., Aslanian A., Yates J.R. III, Rubin S.M., Gozani O., Sage J. J. Biol. Chem. 285:37733-37740(2010) [PubMed: 20870719] [Abstract] Cited for: FUNCTION, INTERACTION WITH RB1. |
| [12] | "Malignant brain tumor repeats: a three-leaved propeller architecture with ligand/peptide binding pockets." Wang W.K., Tereshko V., Boccuni P., MacGrogan D., Nimer S.D., Patel D.J. Structure 11:775-789(2003) [PubMed: 12842041] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 197-527. |
| [13] | "Structural basis for lower lysine methylation state-specific readout by MBT repeats of L3MBTL1 and an engineered PHD finger." Li H., Fischle W., Wang W., Duncan E.M., Liang L., Murakami-Ishibe S., Allis C.D., Patel D.J. Mol. Cell 28:677-691(2007) [PubMed: 18042461] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 206-519 IN COMPLEX WITH MONOMETHYLATED AND DIMETHYLATED PEPTIDES, DOMAIN MBT REPEAT, MUTAGENESIS OF ASP-355 AND ASN-358. |
| [14] | "L3MBTL1 recognition of mono- and dimethylated histones." Min J., Allali-Hassani A., Nady N., Qi C., Ouyang H., Liu Y., MacKenzie F., Vedadi M., Arrowsmith C.H. Nat. Struct. Mol. Biol. 14:1229-1230(2007) [PubMed: 18026117] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.05 ANGSTROMS) OF 200-530 IN COMPLEX WITH DIMETHYLATED HISTONE H4, MUTAGENESIS OF ASP-355 AND CYS-363. |
| [15] | Erratum Min J., Allali-Hassani A., Nady N., Qi C., Ouyang H., Liu Y., MacKenzie F., Vedadi M., Arrowsmith C.H. Nat. Struct. Mol. Biol. 15:114-114(2008) |
| [16] | "The MBT repeats of L3MBTL1 link SET8-mediated p53 methylation at lysine 382 to target gene repression." West L.E., Roy S., Lachmi-Weiner K., Hayashi R., Shi X., Appella E., Kutateladze T.G., Gozani O. J. Biol. Chem. 285:37725-37732(2010) [PubMed: 20870725] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 191-530 IN COMPLEX WITH MONOMETHYLATED PEPTIDE, FUNCTION, INTERACTION WITH TP53, MUTAGENESIS OF ASP-355; ASN-358; PHE-379; TRP-382 AND TYR-386. |
| [17] | "Small molecule ligands of methyl-lysine binding proteins." Structural genomics consortium (SGC) Submitted (NOV-2010) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.55 ANGSTROMS) OF 200-522. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U89358 mRNA. Translation: AAC69438.1. AK299199 mRNA. Translation: BAG61241.1. AL110279 mRNA. Translation: CAB53714.1. AL031681, Z98752 Genomic DNA. Translation: CAI23043.1. Z98752 Genomic DNA. Translation: CAC16800.1. Z98752 Genomic DNA. Translation: CAC18508.1. Z98752, AL031681 Genomic DNA. Translation: CAI42318.1. AL031681, Z98752 Genomic DNA. Translation: CAI23042.1. Sequence problems. Z98752, AL031681 Genomic DNA. Translation: CAI42317.1. Sequence problems. CH471077 Genomic DNA. Translation: EAW75958.1. Sequence problems. CH471077 Genomic DNA. Translation: EAW75961.1. Sequence problems. CH471077 Genomic DNA. Translation: EAW75962.1. Sequence problems. BC039820 mRNA. Translation: AAH39820.1. AB014581 mRNA. Translation: BAA31656.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00216288. IPI00216289. IPI00333371. IPI00879524. IPI00971010. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | T14794. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_056293.4. NM_015478.6. NP_115479.4. NM_032107.4. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.709356. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9Y468. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | Q9Y468. Positions 204-590, 677-745. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-29628N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q9Y468. 4 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-2830196. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | Q9Y468. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9Y468. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 23396689. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q9Y468. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000373134; ENSP00000362226; ENSG00000185513. ENST00000373135; ENSP00000362227; ENSG00000185513. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 26013. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:26013. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002xkl.1. human. uc002xkm.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 26013. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC20P042137. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:15905. L3MBTL1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 608802. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q9Y468. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA30260. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00560000076796. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG071375. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q9Y468. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | EMIDGEA. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG46MBJH. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9Y468. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q9Y468. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_L3MBTL. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9Y468. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000185513. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR004092. Mbt. IPR001660. SAM. IPR013761. SAM/pointed. IPR021129. SAM_type1. IPR002515. Znf_C2HC. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:1.10.150.50. SAM_type. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF02820. MBT. 3 hits. PF00536. SAM_1. 1 hit. PF01530. zf-C2HC. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00561. MBT. 3 hits. SM00454. SAM. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF47769. SAM_homology. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS51079. MBT. 3 hits. PS50105. SAM_DOMAIN. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 47770. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | LMBL1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y468 Secondary accession number(s): B4DRC9 Q9Y4C9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with