Reviewed,
UniProtKB/Swiss-Prot Q9Y468 (LMBL1_HUMAN)
Last modified
June 16, 2009.
Version 91.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Lethal(3)malignant brain tumor-like protein Short name=L(3)mbt-like Alternative name(s): L(3)mbt protein homolog H-l(3)mbt protein Short name=H-L(3)MBT L3MBTL1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 772 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Participates in the ETV6-mediated repression. Probably plays a role in cell proliferation. Overexpression induces multinucleated cells, suggesting that it is required to accomplish normal mitosis. |
| Subunit structure | Homodimer. Interacts with ETV6. Ref.6 |
| Subcellular location | Nucleus. Note: Excluded from the nucleolus. Does not colocalizes with the PcG protein BMI1, suggesting that these two proteins do not belong to the same complex. |
| Tissue specificity | Widely expressed. Expression is reduced in colorectal cancer cell line SW480 and promyelocytic leukemia cell line HL-60. |
| Developmental stage | In interphase cells, it is scattered throughout the nucleoplasm. In mitotic cells, it strongly associates with condensed chromosomes from the prophase to telophase. |
| Sequence similarities | Contains 1 C2HC-type zinc finger. Contains 3 MBT repeats. |
| Sequence caution | The sequence CAC18508.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Zinc-finger |
| Ligand | DNA-binding Metal-binding Zinc |
| Molecular function | Chromatin regulator Repressor |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | chromatin modification Inferred from electronic annotation. Source: UniProtKB-KW regulation of transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW transcriptionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct transcription factor activityInferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| HIST1H1E | P10412 | 3 | EBI-1265089,EBI-358163 | |
| HIST1H4A | P62805 | 2 | EBI-1265089,EBI-302023 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y468-1) Also known as: mbt-I; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y468-2) Also known as: mbt-II; The sequence of this isoform differs from the canonical sequence as follows: 709-772: ARIVRVTHVS...KLSFASDSQY → VRCKCRVGDRAGVTVLKTAGSRCPPQRHFC | ||||||
| Isoform 3 (identifier: Q9Y468-3) The sequence of this isoform differs from the canonical sequence as follows: 1-348: Missing. 709-772: ARIVRVTHVS...KLSFASDSQY → VRCKCRVGDRAGVTVLKTAGSRCPPQRHFC | ||||||
| Isoform 4 (identifier: Q9Y468-4) The sequence of this isoform differs from the canonical sequence as follows: 709-772: ARIVRVTHVS...KLSFASDSQY → MIDGEAFLLL...MFKNADDTLK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 772 | 772 | Lethal(3)malignant brain tumor-like protein | PRO_0000084452 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 206 – 306 | 101 | MBT 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 314 – 413 | 100 | MBT 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 422 – 517 | 96 | MBT 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 552 – 578 | 27 | C2HC-type | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 348 | 348 | Missing in isoform 3. | VSP_003901 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 709 – 772 | 64 | ARIVR…SDSQY → VRCKCRVGDRAGVTVLKTAG SRCPPQRHFC in isoform 2 and isoform 3. | VSP_003902 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 709 – 772 | 64 | ARIVR…SDSQY → MIDGEAFLLLTQADIVKIMS VKLGPALKIYNAILMFKNAD DTLK in isoform 4. | VSP_003903 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 49 | 1 | S → T: dbSNP rs17857202. Ref.4 | VAR_051097 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 479 | 1 | I → M: dbSNP rs6017104. | VAR_051098 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 759 | 1 | H → R: dbSNP rs6030948. | VAR_051099 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 305 | 1 | P → L in AAC69438. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 320 – 321 | 2 | LR → MC in AAC69438. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 332 | 1 | L → M in AAC69438. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 595 | 1 | S → P in AAC69438. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 208 – 215 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 222 – 224 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 227 – 230 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 243 – 248 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 251 – 264 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 267 – 272 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 277 – 279 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 281 – 284 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 295 – 299 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 311 – 313 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 316 – 323 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 330 – 332 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 350 – 354 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 362 – 371 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 374 – 379 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 384 – 386 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 388 – 390 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 402 – 406 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 424 – 430 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 438 – 440 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 454 – 458 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 466 – 474 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 476 – 483 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 488 – 490 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 492 – 495 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 506 – 510 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A human homolog of Drosophila lethal(3)malignant brain tumor (l(3)mbt) protein associates with condensed mitotic chromosomes." Koga H., Matsui S., Hirota T., Takebayashi S., Okumura K., Saya H. Oncogene 18:3799-3809(1999) [PubMed: 10445843] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Brain. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Blocker H., Heubner D., Hoerlein A., Michel G., Wedler H., Kohrer K., Ottenwalder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Uterus. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-49. Tissue: Brain. |
| [5] | "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro." Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:169-176(1998) [PubMed: 9734811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 215-772 (ISOFORM 4). Tissue: Brain. |
| [6] | "The human L(3)MBT Polycomb group protein is a transcriptional repressor and interacts physically and functionally with TEL (ETV6)." Boccuni P., MacGrogan D., Scandura J.M., Nimer S.D. J. Biol. Chem. 278:15412-15420(2003) [PubMed: 12588862] [Abstract] Cited for: INTERACTION WITH ETV6. |
| [7] | "Malignant brain tumor repeats: a three-leaved propeller architecture with ligand/peptide binding pockets." Wang W.K., Tereshko V., Boccuni P., MacGrogan D., Nimer S.D., Patel D.J. Structure 11:775-789(2003) [PubMed: 12842041] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 197-527. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U89358 mRNA. Translation: AAC69438.1. AL110279 mRNA. Translation: CAB53714.1. AL031681, Z98752 Genomic DNA. Translation: CAI23043.1. Z98752 Genomic DNA. Translation: CAC16800.1. Z98752 Genomic DNA. Translation: CAC18508.1. Z98752, AL031681 Genomic DNA. Translation: CAI42318.1. BC039820 mRNA. Translation: AAH39820.1. AB014581 mRNA. Translation: BAA31656.1. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00022956. IPI00216288. IPI00216289. IPI00333371. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | T14794. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_056293.4. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.709356 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q9Y468. 4 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q9Y468. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSG00000185513. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 26013. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:26013. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC20P041576. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0015827. HIX0017445. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:15905. L3MBTL. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 608802. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA30260. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | Q9Y468. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | Q9Y468. PPLSYRS. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9Y468. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q9Y468. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_L3MBTL. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000185513. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR004092. Mbt. IPR013761. SAM_type. IPR002515. Znf_C2HC. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:1.10.150.50. SAM_type. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF02820. MBT. 3 hits. PF01530. zf-C2HC. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00561. MBT. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS51079. MBT. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 47770. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | LMBL1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y468 Secondary accession number(s): Q5H8Y8 Q9Y4C9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


