Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y466

- NR2E1_HUMAN

UniProt

Q9Y466 - NR2E1_HUMAN

Protein

Nuclear receptor subfamily 2 group E member 1

Gene

NR2E1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 137 (01 Oct 2014)
      Sequence version 1 (01 Nov 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half-site sequence 5'-AAGGTCA-3' in which the 5' flanking nucleotides participate in determining receptor specificity By similarity. May be required to pattern anterior brain differentiation. Involved in the regulation of retinal development and essential for vision. During retinogenesis, regulates PTEN-Cyclin D expression via binding to the promoter region of PTEN and suppressing its activity By similarity. May be involved in retinoic acic receptor (RAR) regulation in retinal cells.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi13 – 9078Nuclear receptorPROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri16 – 3621NR C4-typePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri52 – 7827NR C4-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription Source: Ensembl
    2. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: Ensembl
    3. sequence-specific DNA binding Source: InterPro
    4. steroid hormone receptor activity Source: ProtInc
    5. zinc ion binding Source: InterPro

    GO - Biological processi

    1. aggressive behavior Source: Ensembl
    2. amygdala development Source: Ensembl
    3. anterior commissure morphogenesis Source: Ensembl
    4. behavioral fear response Source: Ensembl
    5. cell fate commitment Source: Ensembl
    6. cerebral cortex neuron differentiation Source: Ensembl
    7. dentate gyrus development Source: Ensembl
    8. extracellular matrix organization Source: Ensembl
    9. forebrain generation of neurons Source: Ensembl
    10. gene expression Source: Reactome
    11. glial cell migration Source: Ensembl
    12. layer formation in cerebral cortex Source: Ensembl
    13. long-term synaptic potentiation Source: Ensembl
    14. negative regulation of apoptotic process Source: Ensembl
    15. negative regulation of astrocyte differentiation Source: Ensembl
    16. negative regulation of neural precursor cell proliferation Source: Ensembl
    17. negative regulation of neuron differentiation Source: Ensembl
    18. nervous system development Source: ProtInc
    19. olfactory bulb development Source: Ensembl
    20. positive regulation of angiogenesis Source: Ensembl
    21. positive regulation of cell cycle Source: Ensembl
    22. positive regulation of neural precursor cell proliferation Source: Ensembl
    23. positive regulation of stem cell proliferation Source: Ensembl
    24. regulation of cell migration involved in sprouting angiogenesis Source: Ensembl
    25. regulation of dendrite morphogenesis Source: Ensembl
    26. regulation of timing of neuron differentiation Source: Ensembl
    27. retina development in camera-type eye Source: Ensembl
    28. social behavior Source: Ensembl
    29. somatic stem cell maintenance Source: Ensembl
    30. transcription initiation from RNA polymerase II promoter Source: Reactome
    31. visual perception Source: Ensembl

    Keywords - Molecular functioni

    Activator, Developmental protein, Receptor, Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_15525. Nuclear Receptor transcription pathway.
    SignaLinkiQ9Y466.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nuclear receptor subfamily 2 group E member 1
    Alternative name(s):
    Nuclear receptor TLX
    Protein tailless homolog
    Short name:
    Tll
    Short name:
    hTll
    Gene namesi
    Name:NR2E1
    Synonyms:TLX
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:7973. NR2E1.

    Subcellular locationi

    Nucleus PROSITE-ProRule annotation

    GO - Cellular componenti

    1. nucleoplasm Source: Reactome

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31756.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 385385Nuclear receptor subfamily 2 group E member 1PRO_0000053592Add
    BLAST

    Proteomic databases

    PaxDbiQ9Y466.
    PRIDEiQ9Y466.

    PTM databases

    PhosphoSiteiQ9Y466.

    Expressioni

    Tissue specificityi

    Brain specific. Present in all brain sections tested, highest levels in the caudate nucleus and hippocampus, weakest levels in the thalamus.1 Publication

    Gene expression databases

    ArrayExpressiQ9Y466.
    BgeeiQ9Y466.
    CleanExiHS_NR2E1.
    GenevestigatoriQ9Y466.

    Organism-specific databases

    HPAiHPA036954.

    Interactioni

    Subunit structurei

    Monomer. Interacts with ATN1; the interaction represses the transcription.By similarity

    Protein-protein interaction databases

    BioGridi112956. 14 interactions.
    STRINGi9606.ENSP00000357982.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Y466.
    SMRiQ9Y466. Positions 16-382.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni187 – 354168Ligand-bindingBy similarityAdd
    BLAST
    Regioni341 – 38545Required for transcriptional repressionBy similarityAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi343 – 3475Poly-Leu

    Sequence similaritiesi

    Contains 1 nuclear receptor DNA-binding domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri16 – 3621NR C4-typePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri52 – 7827NR C4-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Zinc-finger

    Phylogenomic databases

    eggNOGiNOG277339.
    HOGENOMiHOG000260820.
    HOVERGENiHBG005606.
    KOiK08545.
    OrthoDBiEOG7WT41C.
    PhylomeDBiQ9Y466.
    TreeFamiTF315716.

    Family and domain databases

    Gene3Di1.10.565.10. 2 hits.
    3.30.50.10. 1 hit.
    InterProiIPR008946. Nucl_hormone_rcpt_ligand-bd.
    IPR000536. Nucl_hrmn_rcpt_lig-bd_core.
    IPR001723. Str_hrmn_rcpt.
    IPR001628. Znf_hrmn_rcpt.
    IPR013088. Znf_NHR/GATA.
    [Graphical view]
    PfamiPF00104. Hormone_recep. 1 hit.
    PF00105. zf-C4. 1 hit.
    [Graphical view]
    PRINTSiPR00398. STRDHORMONER.
    PR00047. STROIDFINGER.
    SMARTiSM00430. HOLI. 1 hit.
    SM00399. ZnF_C4. 1 hit.
    [Graphical view]
    SUPFAMiSSF48508. SSF48508. 1 hit.
    PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
    PS51030. NUCLEAR_REC_DBD_2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9Y466-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSKPAGSTSR ILDIPCKVCG DRSSGKHYGV YACDGCSGFF KRSIRRNRTY    50
    VCKSGNQGGC PVDKTHRNQC RACRLKKCLE VNMNKDAVQH ERGPRTSTIR 100
    KQVALYFRGH KEENGAAAHF PSAALPAPAF FTAVTQLEPH GLELAAVSTT 150
    PERQTLVSLA QPTPKYPHEV NGTPMYLYEV ATESVCESAA RLLFMSIKWA 200
    KSVPAFSTLS LQDQLMLLED AWRELFVLGI AQWAIPVDAN TLLAVSGMNG 250
    DNTDSQKLNK IISEIQALQE VVARFRQLRL DATEFACLKC IVTFKAVPTH 300
    SGSELRSFRN AAAIAALQDE AQLTLNSYIH TRYPTQPCRF GKLLLLLPAL 350
    RSISPSTIEE VFFKKTIGNV PITRLLSDMY KSSDI 385
    Length:385
    Mass (Da):42,589
    Last modified:November 1, 1999 - v1
    Checksum:i39181A42A2FB79C2
    GO
    Isoform 2 (identifier: Q9Y466-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-9: MSKPAGSTS → MFRAGAEGAEKEPSPRPECRADPGPGLGFPLGSGLPWPSLLESPGG

    Note: No experimental confirmation available.

    Show »
    Length:422
    Mass (Da):46,400
    Checksum:iA79AF556F5FB0840
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 99MSKPAGSTS → MFRAGAEGAEKEPSPRPECR ADPGPGLGFPLGSGLPWPSL LESPGG in isoform 2. 1 PublicationVSP_054639

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y13276 mRNA. Translation: CAA73725.1.
    AF220532 mRNA. Translation: AAG31945.1.
    AF411525 mRNA. Translation: AAL05871.1.
    AK131541 mRNA. Translation: BAD18677.1.
    AL078596 Genomic DNA. Translation: CAB75626.1.
    CH471051 Genomic DNA. Translation: EAW48386.1.
    BC028031 mRNA. Translation: AAH28031.1.
    CCDSiCCDS5063.1. [Q9Y466-1]
    CCDS69165.1. [Q9Y466-2]
    RefSeqiNP_001273031.1. NM_001286102.1. [Q9Y466-2]
    NP_003260.1. NM_003269.4. [Q9Y466-1]
    UniGeneiHs.157688.

    Genome annotation databases

    EnsembliENST00000368983; ENSP00000357979; ENSG00000112333. [Q9Y466-2]
    ENST00000368986; ENSP00000357982; ENSG00000112333. [Q9Y466-1]
    GeneIDi7101.
    KEGGihsa:7101.
    UCSCiuc003psg.3. human. [Q9Y466-1]

    Polymorphism databases

    DMDMi9910804.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y13276 mRNA. Translation: CAA73725.1 .
    AF220532 mRNA. Translation: AAG31945.1 .
    AF411525 mRNA. Translation: AAL05871.1 .
    AK131541 mRNA. Translation: BAD18677.1 .
    AL078596 Genomic DNA. Translation: CAB75626.1 .
    CH471051 Genomic DNA. Translation: EAW48386.1 .
    BC028031 mRNA. Translation: AAH28031.1 .
    CCDSi CCDS5063.1. [Q9Y466-1 ]
    CCDS69165.1. [Q9Y466-2 ]
    RefSeqi NP_001273031.1. NM_001286102.1. [Q9Y466-2 ]
    NP_003260.1. NM_003269.4. [Q9Y466-1 ]
    UniGenei Hs.157688.

    3D structure databases

    ProteinModelPortali Q9Y466.
    SMRi Q9Y466. Positions 16-382.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112956. 14 interactions.
    STRINGi 9606.ENSP00000357982.

    Chemistry

    ChEMBLi CHEMBL1961788.

    PTM databases

    PhosphoSitei Q9Y466.

    Polymorphism databases

    DMDMi 9910804.

    Proteomic databases

    PaxDbi Q9Y466.
    PRIDEi Q9Y466.

    Protocols and materials databases

    DNASUi 7101.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000368983 ; ENSP00000357979 ; ENSG00000112333 . [Q9Y466-2 ]
    ENST00000368986 ; ENSP00000357982 ; ENSG00000112333 . [Q9Y466-1 ]
    GeneIDi 7101.
    KEGGi hsa:7101.
    UCSCi uc003psg.3. human. [Q9Y466-1 ]

    Organism-specific databases

    CTDi 7101.
    GeneCardsi GC06P108487.
    HGNCi HGNC:7973. NR2E1.
    HPAi HPA036954.
    MIMi 603849. gene.
    neXtProti NX_Q9Y466.
    PharmGKBi PA31756.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG277339.
    HOGENOMi HOG000260820.
    HOVERGENi HBG005606.
    KOi K08545.
    OrthoDBi EOG7WT41C.
    PhylomeDBi Q9Y466.
    TreeFami TF315716.

    Enzyme and pathway databases

    Reactomei REACT_15525. Nuclear Receptor transcription pathway.
    SignaLinki Q9Y466.

    Miscellaneous databases

    GeneWikii TLX.
    GenomeRNAii 7101.
    NextBioi 27781.
    PROi Q9Y466.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9Y466.
    Bgeei Q9Y466.
    CleanExi HS_NR2E1.
    Genevestigatori Q9Y466.

    Family and domain databases

    Gene3Di 1.10.565.10. 2 hits.
    3.30.50.10. 1 hit.
    InterProi IPR008946. Nucl_hormone_rcpt_ligand-bd.
    IPR000536. Nucl_hrmn_rcpt_lig-bd_core.
    IPR001723. Str_hrmn_rcpt.
    IPR001628. Znf_hrmn_rcpt.
    IPR013088. Znf_NHR/GATA.
    [Graphical view ]
    Pfami PF00104. Hormone_recep. 1 hit.
    PF00105. zf-C4. 1 hit.
    [Graphical view ]
    PRINTSi PR00398. STRDHORMONER.
    PR00047. STROIDFINGER.
    SMARTi SM00430. HOLI. 1 hit.
    SM00399. ZnF_C4. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48508. SSF48508. 1 hit.
    PROSITEi PS00031. NUCLEAR_REC_DBD_1. 1 hit.
    PS51030. NUCLEAR_REC_DBD_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The human homologue of the Drosophila tailless gene (TLX): characterization and mapping to a region of common deletion in human lymphoid leukemia on chromosome 6q21."
      Jackson A., Panayiotidis P., Foroni L.
      Genomics 50:34-43(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Fetal brain.
    2. "Cell-type-specific regulation of the retinoic acid receptor mediated by the orphan nuclear receptor TLX."
      Kobayashi M., Yu R.T., Yasuda K., Umesono K.
      Mol. Cell. Biol. 20:8731-8739(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), POSSIBLE FUNCTION.
      Tissue: Brain.
    3. Hua F., Wu J., Zhang B., Peng X., Yuan J., Qiang B.
      Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Caudate nucleus.
    5. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.

    Entry informationi

    Entry nameiNR2E1_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y466
    Secondary accession number(s): Q6ZMP8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: November 1, 1999
    Last modified: October 1, 2014
    This is version 137 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3