SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Y421

- FA32A_HUMAN

UniProt

Q9Y421 - FA32A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Protein FAM32A
Gene
FAM32A, OTAG12, CGI-144
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli.1 Publication

GO - Molecular functioni

  1. poly(A) RNA binding Source: UniProtKB
  2. protein binding Source: IntAct

GO - Biological processi

  1. apoptotic process Source: UniProtKB-KW
  2. cell cycle Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Apoptosis, Cell cycle

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM32A
Alternative name(s):
Ovarian tumor-associated gene 12
Short name:
OTAG-12
Gene namesi
Name:FAM32A
Synonyms:OTAG12
ORF Names:CGI-144
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:24563. FAM32A.

Subcellular locationi

Isoform 1 : Nucleus 1 Publication
Isoform 2 : Nucleus 1 Publication

GO - Cellular componenti

  1. intracellular membrane-bounded organelle Source: HPA
  2. mitochondrion Source: HPA
  3. nucleolus Source: LIFEdb
  4. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134956082.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 112112Protein FAM32A
PRO_0000223250Add
BLAST

Proteomic databases

MaxQBiQ9Y421.
PaxDbiQ9Y421.
PeptideAtlasiQ9Y421.
PRIDEiQ9Y421.

PTM databases

PhosphoSiteiQ9Y421.

Expressioni

Tissue specificityi

Expressed in ovary, with isoform 1 being predominant.1 Publication

Inductioni

By etoposide, puromycin or carboplatin.1 Publication

Gene expression databases

ArrayExpressiQ9Y421.
BgeeiQ9Y421.
CleanExiHS_FAM32A.
GenevestigatoriQ9Y421.

Organism-specific databases

HPAiHPA051712.
HPA053237.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CWC22Q9HCG82EBI-726146,EBI-373289

Protein-protein interaction databases

BioGridi117488. 3 interactions.
IntActiQ9Y421. 2 interactions.
MINTiMINT-4719598.
STRINGi9606.ENSP00000263384.

Structurei

3D structure databases

ProteinModelPortaliQ9Y421.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi9 – 8678Lys-rich
Add
BLAST

Sequence similaritiesi

Belongs to the FAM32 family.

Phylogenomic databases

eggNOGiNOG145183.
HOGENOMiHOG000205758.
HOVERGENiHBG081504.
InParanoidiQ9Y421.
KOiK13120.
OMAiNQDEERT.
PhylomeDBiQ9Y421.
TreeFamiTF314020.

Family and domain databases

InterProiIPR013865. DUF1754_euk.
[Graphical view]
PANTHERiPTHR13282. PTHR13282. 1 hit.
PfamiPF08555. DUF1754. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9Y421-1) [UniParc]FASTAAdd to Basket

Also known as: OTAG-12b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEAYEQVQKG PLKLKGVAEL GVTKRKKKKK DKDKAKLLEA MGTSKKNEEE    50
KRRGLDKRTP AQAAFEKMQE KRQMERILKK ASKTHKQRVE DFNRHLDTLT 100
EHYDIPKVSW TK 112
Length:112
Mass (Da):13,178
Last modified:May 1, 2000 - v2
Checksum:i7FAF15315E9D580C
GO
Isoform 2 (identifier: Q9Y421-2) [UniParc]FASTAAdd to Basket

Also known as: OTAG-12a

The sequence of this isoform differs from the canonical sequence as follows:
     74-112: MERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK → GHQTSCIATGFQGHKANAARSYAWIQNWYCVPSS

Show »
Length:107
Mass (Da):12,139
Checksum:iB8782C7C98B2953D
GO
Isoform 3 (identifier: Q9Y421-3) [UniParc]FASTAAdd to Basket

Also known as: OTAG-12c

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MEAYEQVQKGPLKLKGVAELGVTK → MSFS

Show »
Length:92
Mass (Da):11,032
Checksum:i45051BB82E2515F8
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2424MEAYE…LGVTK → MSFS in isoform 3.
VSP_043860Add
BLAST
Alternative sequencei74 – 11239MERIL…VSWTK → GHQTSCIATGFQGHKANAAR SYAWIQNWYCVPSS in isoform 2.
VSP_043861Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF151902 mRNA. Translation: AAD34139.1.
AL050157 mRNA. Translation: CAB43298.2.
BC000639 mRNA. Translation: AAH00639.1.
BC004447 mRNA. Translation: AAH04447.1.
BC017286 mRNA. Translation: AAH17286.1.
BU543240 mRNA. No translation available.
CCDSiCCDS12341.1. [Q9Y421-1]
PIRiT08783.
RefSeqiNP_054796.1. NM_014077.2. [Q9Y421-1]
UniGeneiHs.631614.

Genome annotation databases

EnsembliENST00000263384; ENSP00000263384; ENSG00000105058. [Q9Y421-1]
ENST00000589852; ENSP00000465969; ENSG00000105058. [Q9Y421-3]
GeneIDi26017.
KEGGihsa:26017.
UCSCiuc002ndt.3. human. [Q9Y421-1]

Polymorphism databases

DMDMi74753494.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF151902 mRNA. Translation: AAD34139.1 .
AL050157 mRNA. Translation: CAB43298.2 .
BC000639 mRNA. Translation: AAH00639.1 .
BC004447 mRNA. Translation: AAH04447.1 .
BC017286 mRNA. Translation: AAH17286.1 .
BU543240 mRNA. No translation available.
CCDSi CCDS12341.1. [Q9Y421-1 ]
PIRi T08783.
RefSeqi NP_054796.1. NM_014077.2. [Q9Y421-1 ]
UniGenei Hs.631614.

3D structure databases

ProteinModelPortali Q9Y421.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117488. 3 interactions.
IntActi Q9Y421. 2 interactions.
MINTi MINT-4719598.
STRINGi 9606.ENSP00000263384.

PTM databases

PhosphoSitei Q9Y421.

Polymorphism databases

DMDMi 74753494.

Proteomic databases

MaxQBi Q9Y421.
PaxDbi Q9Y421.
PeptideAtlasi Q9Y421.
PRIDEi Q9Y421.

Protocols and materials databases

DNASUi 26017.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000263384 ; ENSP00000263384 ; ENSG00000105058 . [Q9Y421-1 ]
ENST00000589852 ; ENSP00000465969 ; ENSG00000105058 . [Q9Y421-3 ]
GeneIDi 26017.
KEGGi hsa:26017.
UCSCi uc002ndt.3. human. [Q9Y421-1 ]

Organism-specific databases

CTDi 26017.
GeneCardsi GC19P017362.
H-InvDB HIX0014865.
HGNCi HGNC:24563. FAM32A.
HPAi HPA051712.
HPA053237.
MIMi 614554. gene.
neXtProti NX_Q9Y421.
PharmGKBi PA134956082.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG145183.
HOGENOMi HOG000205758.
HOVERGENi HBG081504.
InParanoidi Q9Y421.
KOi K13120.
OMAi NQDEERT.
PhylomeDBi Q9Y421.
TreeFami TF314020.

Miscellaneous databases

GeneWikii FAM32A.
GenomeRNAii 26017.
NextBioi 47780.
PROi Q9Y421.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9Y421.
Bgeei Q9Y421.
CleanExi HS_FAM32A.
Genevestigatori Q9Y421.

Family and domain databases

InterProi IPR013865. DUF1754_euk.
[Graphical view ]
PANTHERi PTHR13282. PTHR13282. 1 hit.
Pfami PF08555. DUF1754. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
    Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
    Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Uterus.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain, Lung and Lymph.
  4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  5. "Anti-proliferative and pro-apoptotic actions of a novel human and mouse ovarian tumor-associated gene OTAG-12: downregulation, alternative splicing and drug sensitization."
    Chen X., Zhang H., Aravindakshan J.P., Gotlieb W.H., Sairam M.R.
    Oncogene 30:2874-2887(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING, INDUCTION.

Entry informationi

Entry nameiFA32A_HUMAN
AccessioniPrimary (citable) accession number: Q9Y421
Secondary accession number(s): Q9BT02
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: May 1, 2000
Last modified: July 9, 2014
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi