Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM32A

Gene

FAM32A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli.1 Publication

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis, Cell cycle

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM32A
Alternative name(s):
Ovarian tumor-associated gene 12
Short name:
OTAG-12
Gene namesi
Name:FAM32A
Synonyms:OTAG12
ORF Names:CGI-144
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:24563. FAM32A.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134956082.

Polymorphism and mutation databases

BioMutaiFAM32A.
DMDMi74753494.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 112112Protein FAM32APRO_0000223250Add
BLAST

Proteomic databases

MaxQBiQ9Y421.
PaxDbiQ9Y421.
PeptideAtlasiQ9Y421.
PRIDEiQ9Y421.

PTM databases

PhosphoSiteiQ9Y421.

Expressioni

Tissue specificityi

Expressed in ovary, with isoform 1 being predominant.1 Publication

Inductioni

By etoposide, puromycin or carboplatin.1 Publication

Gene expression databases

BgeeiQ9Y421.
CleanExiHS_FAM32A.
ExpressionAtlasiQ9Y421. baseline and differential.
GenevisibleiQ9Y421. HS.

Organism-specific databases

HPAiHPA051712.
HPA053237.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CWC22Q9HCG82EBI-726146,EBI-373289

Protein-protein interaction databases

BioGridi117488. 3 interactions.
IntActiQ9Y421. 2 interactions.
MINTiMINT-4719598.
STRINGi9606.ENSP00000263384.

Structurei

3D structure databases

ProteinModelPortaliQ9Y421.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi9 – 8678Lys-richAdd
BLAST

Sequence similaritiesi

Belongs to the FAM32 family.Curated

Phylogenomic databases

eggNOGiNOG145183.
GeneTreeiENSGT00390000013811.
HOGENOMiHOG000205758.
HOVERGENiHBG081504.
InParanoidiQ9Y421.
KOiK13120.
OMAiTEADKMG.
PhylomeDBiQ9Y421.
TreeFamiTF314020.

Family and domain databases

InterProiIPR013865. DUF1754_euk.
[Graphical view]
PANTHERiPTHR13282. PTHR13282. 1 hit.
PfamiPF08555. DUF1754. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y421-1) [UniParc]FASTAAdd to basket

Also known as: OTAG-12b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAYEQVQKG PLKLKGVAEL GVTKRKKKKK DKDKAKLLEA MGTSKKNEEE
60 70 80 90 100
KRRGLDKRTP AQAAFEKMQE KRQMERILKK ASKTHKQRVE DFNRHLDTLT
110
EHYDIPKVSW TK
Length:112
Mass (Da):13,178
Last modified:May 1, 2000 - v2
Checksum:i7FAF15315E9D580C
GO
Isoform 2 (identifier: Q9Y421-2) [UniParc]FASTAAdd to basket

Also known as: OTAG-12a

The sequence of this isoform differs from the canonical sequence as follows:
     74-112: MERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK → GHQTSCIATGFQGHKANAARSYAWIQNWYCVPSS

Show »
Length:107
Mass (Da):12,139
Checksum:iB8782C7C98B2953D
GO
Isoform 3 (identifier: Q9Y421-3) [UniParc]FASTAAdd to basket

Also known as: OTAG-12c

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MEAYEQVQKGPLKLKGVAELGVTK → MSFS

Show »
Length:92
Mass (Da):11,032
Checksum:i45051BB82E2515F8
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2424MEAYE…LGVTK → MSFS in isoform 3. CuratedVSP_043860Add
BLAST
Alternative sequencei74 – 11239MERIL…VSWTK → GHQTSCIATGFQGHKANAAR SYAWIQNWYCVPSS in isoform 2. 1 PublicationVSP_043861Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF151902 mRNA. Translation: AAD34139.1.
AL050157 mRNA. Translation: CAB43298.2.
BC000639 mRNA. Translation: AAH00639.1.
BC004447 mRNA. Translation: AAH04447.1.
BC017286 mRNA. Translation: AAH17286.1.
BU543240 mRNA. No translation available.
CCDSiCCDS12341.1. [Q9Y421-1]
PIRiT08783.
RefSeqiNP_054796.1. NM_014077.3. [Q9Y421-1]
UniGeneiHs.631614.

Genome annotation databases

EnsembliENST00000263384; ENSP00000263384; ENSG00000105058. [Q9Y421-1]
ENST00000589852; ENSP00000465969; ENSG00000105058. [Q9Y421-3]
GeneIDi26017.
KEGGihsa:26017.
UCSCiuc002ndt.3. human. [Q9Y421-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF151902 mRNA. Translation: AAD34139.1.
AL050157 mRNA. Translation: CAB43298.2.
BC000639 mRNA. Translation: AAH00639.1.
BC004447 mRNA. Translation: AAH04447.1.
BC017286 mRNA. Translation: AAH17286.1.
BU543240 mRNA. No translation available.
CCDSiCCDS12341.1. [Q9Y421-1]
PIRiT08783.
RefSeqiNP_054796.1. NM_014077.3. [Q9Y421-1]
UniGeneiHs.631614.

3D structure databases

ProteinModelPortaliQ9Y421.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117488. 3 interactions.
IntActiQ9Y421. 2 interactions.
MINTiMINT-4719598.
STRINGi9606.ENSP00000263384.

PTM databases

PhosphoSiteiQ9Y421.

Polymorphism and mutation databases

BioMutaiFAM32A.
DMDMi74753494.

Proteomic databases

MaxQBiQ9Y421.
PaxDbiQ9Y421.
PeptideAtlasiQ9Y421.
PRIDEiQ9Y421.

Protocols and materials databases

DNASUi26017.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263384; ENSP00000263384; ENSG00000105058. [Q9Y421-1]
ENST00000589852; ENSP00000465969; ENSG00000105058. [Q9Y421-3]
GeneIDi26017.
KEGGihsa:26017.
UCSCiuc002ndt.3. human. [Q9Y421-1]

Organism-specific databases

CTDi26017.
GeneCardsiGC19P017894.
H-InvDBHIX0014865.
HGNCiHGNC:24563. FAM32A.
HPAiHPA051712.
HPA053237.
MIMi614554. gene.
neXtProtiNX_Q9Y421.
PharmGKBiPA134956082.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG145183.
GeneTreeiENSGT00390000013811.
HOGENOMiHOG000205758.
HOVERGENiHBG081504.
InParanoidiQ9Y421.
KOiK13120.
OMAiTEADKMG.
PhylomeDBiQ9Y421.
TreeFamiTF314020.

Miscellaneous databases

GeneWikiiFAM32A.
GenomeRNAii26017.
NextBioi47780.
PROiQ9Y421.
SOURCEiSearch...

Gene expression databases

BgeeiQ9Y421.
CleanExiHS_FAM32A.
ExpressionAtlasiQ9Y421. baseline and differential.
GenevisibleiQ9Y421. HS.

Family and domain databases

InterProiIPR013865. DUF1754_euk.
[Graphical view]
PANTHERiPTHR13282. PTHR13282. 1 hit.
PfamiPF08555. DUF1754. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
    Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
    Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Uterus.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain, Lung and Lymph.
  4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  5. "Anti-proliferative and pro-apoptotic actions of a novel human and mouse ovarian tumor-associated gene OTAG-12: downregulation, alternative splicing and drug sensitization."
    Chen X., Zhang H., Aravindakshan J.P., Gotlieb W.H., Sairam M.R.
    Oncogene 30:2874-2887(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING, INDUCTION.

Entry informationi

Entry nameiFA32A_HUMAN
AccessioniPrimary (citable) accession number: Q9Y421
Secondary accession number(s): Q9BT02
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: May 1, 2000
Last modified: June 24, 2015
This is version 111 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.