Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Y421 (FA32A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 104. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein FAM32A
Alternative name(s):
Ovarian tumor-associated gene 12
Short name=OTAG-12
Gene names
Name:FAM32A
Synonyms:OTAG12
ORF Names:CGI-144
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length112 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli. Ref.5

Subcellular location

Isoform 1: Nucleus Ref.5.

Isoform 2: Nucleus Ref.5.

Tissue specificity

Expressed in ovary, with isoform 1 being predominant. Ref.5

Induction

By etoposide, puromycin or carboplatin. Ref.5

Sequence similarities

Belongs to the FAM32 family.

Ontologies

Binary interactions

With

Entry

#Exp.

IntAct

Notes

CWC22Q9HCG82EBI-726146,EBI-373289

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9Y421-1)

Also known as: OTAG-12b;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9Y421-2)

Also known as: OTAG-12a;

The sequence of this isoform differs from the canonical sequence as follows:
     74-112: MERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK → GHQTSCIATGFQGHKANAARSYAWIQNWYCVPSS
Isoform 3 (identifier: Q9Y421-3)

Also known as: OTAG-12c;

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MEAYEQVQKGPLKLKGVAELGVTK → MSFS

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 112112Protein FAM32A
PRO_0000223250

Regions

Compositional bias9 – 8678Lys-rich

Natural variations

Alternative sequence1 – 2424MEAYE…LGVTK → MSFS in isoform 3.
VSP_043860
Alternative sequence74 – 11239MERIL…VSWTK → GHQTSCIATGFQGHKANAAR SYAWIQNWYCVPSS in isoform 2.
VSP_043861

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (OTAG-12b) [UniParc].

Last modified May 1, 2000. Version 2.
Checksum: 7FAF15315E9D580C

FASTA11213,178
        10         20         30         40         50         60 
MEAYEQVQKG PLKLKGVAEL GVTKRKKKKK DKDKAKLLEA MGTSKKNEEE KRRGLDKRTP 

        70         80         90        100        110 
AQAAFEKMQE KRQMERILKK ASKTHKQRVE DFNRHLDTLT EHYDIPKVSW TK 

« Hide

Isoform 2 (OTAG-12a) [UniParc].

Checksum: B8782C7C98B2953D
Show »

FASTA10712,139
Isoform 3 (OTAG-12c) [UniParc].

Checksum: 45051BB82E2515F8
Show »

FASTA9211,032

References

« Hide 'large scale' references
[1]"Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[2]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Uterus.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain, Lung and Lymph.
[4]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[5]"Anti-proliferative and pro-apoptotic actions of a novel human and mouse ovarian tumor-associated gene OTAG-12: downregulation, alternative splicing and drug sensitization."
Chen X., Zhang H., Aravindakshan J.P., Gotlieb W.H., Sairam M.R.
Oncogene 30:2874-2887(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING, INDUCTION.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF151902 mRNA. Translation: AAD34139.1.
AL050157 mRNA. Translation: CAB43298.2.
BC000639 mRNA. Translation: AAH00639.1.
BC004447 mRNA. Translation: AAH04447.1.
BC017286 mRNA. Translation: AAH17286.1.
BU543240 mRNA. No translation available.
CCDSCCDS12341.1. [Q9Y421-1]
PIRT08783.
RefSeqNP_054796.1. NM_014077.2. [Q9Y421-1]
UniGeneHs.631614.

3D structure databases

ProteinModelPortalQ9Y421.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid117488. 3 interactions.
IntActQ9Y421. 2 interactions.
MINTMINT-4719598.
STRING9606.ENSP00000263384.

PTM databases

PhosphoSiteQ9Y421.

Polymorphism databases

DMDM74753494.

Proteomic databases

MaxQBQ9Y421.
PaxDbQ9Y421.
PeptideAtlasQ9Y421.
PRIDEQ9Y421.

Protocols and materials databases

DNASU26017.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000263384; ENSP00000263384; ENSG00000105058. [Q9Y421-1]
ENST00000589852; ENSP00000465969; ENSG00000105058. [Q9Y421-3]
GeneID26017.
KEGGhsa:26017.
UCSCuc002ndt.3. human. [Q9Y421-1]

Organism-specific databases

CTD26017.
GeneCardsGC19P017362.
H-InvDBHIX0014865.
HGNCHGNC:24563. FAM32A.
HPAHPA051712.
HPA053237.
MIM614554. gene.
neXtProtNX_Q9Y421.
PharmGKBPA134956082.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG145183.
HOGENOMHOG000205758.
HOVERGENHBG081504.
InParanoidQ9Y421.
KOK13120.
OMANQDEERT.
PhylomeDBQ9Y421.
TreeFamTF314020.

Gene expression databases

ArrayExpressQ9Y421.
BgeeQ9Y421.
CleanExHS_FAM32A.
GenevestigatorQ9Y421.

Family and domain databases

InterProIPR013865. DUF1754_euk.
[Graphical view]
PANTHERPTHR13282. PTHR13282. 1 hit.
PfamPF08555. DUF1754. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiFAM32A.
GenomeRNAi26017.
NextBio47780.
PROQ9Y421.
SOURCESearch...

Entry information

Entry nameFA32A_HUMAN
AccessionPrimary (citable) accession number: Q9Y421
Secondary accession number(s): Q9BT02
Entry history
Integrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: May 1, 2000
Last modified: July 9, 2014
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM