Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y421

- FA32A_HUMAN

UniProt

Q9Y421 - FA32A_HUMAN

Protein

Protein FAM32A

Gene

FAM32A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli.1 Publication

    GO - Molecular functioni

    1. poly(A) RNA binding Source: UniProtKB
    2. protein binding Source: IntAct

    GO - Biological processi

    1. apoptotic process Source: UniProtKB-KW
    2. cell cycle Source: UniProtKB-KW

    Keywords - Biological processi

    Apoptosis, Cell cycle

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein FAM32A
    Alternative name(s):
    Ovarian tumor-associated gene 12
    Short name:
    OTAG-12
    Gene namesi
    Name:FAM32A
    Synonyms:OTAG12
    ORF Names:CGI-144
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:24563. FAM32A.

    Subcellular locationi

    GO - Cellular componenti

    1. intracellular membrane-bounded organelle Source: HPA
    2. mitochondrion Source: HPA
    3. nucleolus Source: LIFEdb
    4. nucleus Source: HPA

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134956082.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 112112Protein FAM32APRO_0000223250Add
    BLAST

    Proteomic databases

    MaxQBiQ9Y421.
    PaxDbiQ9Y421.
    PeptideAtlasiQ9Y421.
    PRIDEiQ9Y421.

    PTM databases

    PhosphoSiteiQ9Y421.

    Expressioni

    Tissue specificityi

    Expressed in ovary, with isoform 1 being predominant.1 Publication

    Inductioni

    By etoposide, puromycin or carboplatin.1 Publication

    Gene expression databases

    ArrayExpressiQ9Y421.
    BgeeiQ9Y421.
    CleanExiHS_FAM32A.
    GenevestigatoriQ9Y421.

    Organism-specific databases

    HPAiHPA051712.
    HPA053237.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CWC22Q9HCG82EBI-726146,EBI-373289

    Protein-protein interaction databases

    BioGridi117488. 4 interactions.
    IntActiQ9Y421. 2 interactions.
    MINTiMINT-4719598.
    STRINGi9606.ENSP00000263384.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Y421.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi9 – 8678Lys-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the FAM32 family.Curated

    Phylogenomic databases

    eggNOGiNOG145183.
    HOGENOMiHOG000205758.
    HOVERGENiHBG081504.
    InParanoidiQ9Y421.
    KOiK13120.
    OMAiNQDEERT.
    PhylomeDBiQ9Y421.
    TreeFamiTF314020.

    Family and domain databases

    InterProiIPR013865. DUF1754_euk.
    [Graphical view]
    PANTHERiPTHR13282. PTHR13282. 1 hit.
    PfamiPF08555. DUF1754. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9Y421-1) [UniParc]FASTAAdd to Basket

    Also known as: OTAG-12b

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEAYEQVQKG PLKLKGVAEL GVTKRKKKKK DKDKAKLLEA MGTSKKNEEE    50
    KRRGLDKRTP AQAAFEKMQE KRQMERILKK ASKTHKQRVE DFNRHLDTLT 100
    EHYDIPKVSW TK 112
    Length:112
    Mass (Da):13,178
    Last modified:May 1, 2000 - v2
    Checksum:i7FAF15315E9D580C
    GO
    Isoform 2 (identifier: Q9Y421-2) [UniParc]FASTAAdd to Basket

    Also known as: OTAG-12a

    The sequence of this isoform differs from the canonical sequence as follows:
         74-112: MERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK → GHQTSCIATGFQGHKANAARSYAWIQNWYCVPSS

    Show »
    Length:107
    Mass (Da):12,139
    Checksum:iB8782C7C98B2953D
    GO
    Isoform 3 (identifier: Q9Y421-3) [UniParc]FASTAAdd to Basket

    Also known as: OTAG-12c

    The sequence of this isoform differs from the canonical sequence as follows:
         1-24: MEAYEQVQKGPLKLKGVAELGVTK → MSFS

    Show »
    Length:92
    Mass (Da):11,032
    Checksum:i45051BB82E2515F8
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2424MEAYE…LGVTK → MSFS in isoform 3. CuratedVSP_043860Add
    BLAST
    Alternative sequencei74 – 11239MERIL…VSWTK → GHQTSCIATGFQGHKANAAR SYAWIQNWYCVPSS in isoform 2. 1 PublicationVSP_043861Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF151902 mRNA. Translation: AAD34139.1.
    AL050157 mRNA. Translation: CAB43298.2.
    BC000639 mRNA. Translation: AAH00639.1.
    BC004447 mRNA. Translation: AAH04447.1.
    BC017286 mRNA. Translation: AAH17286.1.
    BU543240 mRNA. No translation available.
    CCDSiCCDS12341.1. [Q9Y421-1]
    PIRiT08783.
    RefSeqiNP_054796.1. NM_014077.2. [Q9Y421-1]
    UniGeneiHs.631614.

    Genome annotation databases

    EnsembliENST00000263384; ENSP00000263384; ENSG00000105058. [Q9Y421-1]
    ENST00000589852; ENSP00000465969; ENSG00000105058. [Q9Y421-3]
    GeneIDi26017.
    KEGGihsa:26017.
    UCSCiuc002ndt.3. human. [Q9Y421-1]

    Polymorphism databases

    DMDMi74753494.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF151902 mRNA. Translation: AAD34139.1 .
    AL050157 mRNA. Translation: CAB43298.2 .
    BC000639 mRNA. Translation: AAH00639.1 .
    BC004447 mRNA. Translation: AAH04447.1 .
    BC017286 mRNA. Translation: AAH17286.1 .
    BU543240 mRNA. No translation available.
    CCDSi CCDS12341.1. [Q9Y421-1 ]
    PIRi T08783.
    RefSeqi NP_054796.1. NM_014077.2. [Q9Y421-1 ]
    UniGenei Hs.631614.

    3D structure databases

    ProteinModelPortali Q9Y421.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117488. 4 interactions.
    IntActi Q9Y421. 2 interactions.
    MINTi MINT-4719598.
    STRINGi 9606.ENSP00000263384.

    PTM databases

    PhosphoSitei Q9Y421.

    Polymorphism databases

    DMDMi 74753494.

    Proteomic databases

    MaxQBi Q9Y421.
    PaxDbi Q9Y421.
    PeptideAtlasi Q9Y421.
    PRIDEi Q9Y421.

    Protocols and materials databases

    DNASUi 26017.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000263384 ; ENSP00000263384 ; ENSG00000105058 . [Q9Y421-1 ]
    ENST00000589852 ; ENSP00000465969 ; ENSG00000105058 . [Q9Y421-3 ]
    GeneIDi 26017.
    KEGGi hsa:26017.
    UCSCi uc002ndt.3. human. [Q9Y421-1 ]

    Organism-specific databases

    CTDi 26017.
    GeneCardsi GC19P017362.
    H-InvDB HIX0014865.
    HGNCi HGNC:24563. FAM32A.
    HPAi HPA051712.
    HPA053237.
    MIMi 614554. gene.
    neXtProti NX_Q9Y421.
    PharmGKBi PA134956082.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG145183.
    HOGENOMi HOG000205758.
    HOVERGENi HBG081504.
    InParanoidi Q9Y421.
    KOi K13120.
    OMAi NQDEERT.
    PhylomeDBi Q9Y421.
    TreeFami TF314020.

    Miscellaneous databases

    GeneWikii FAM32A.
    GenomeRNAii 26017.
    NextBioi 47780.
    PROi Q9Y421.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9Y421.
    Bgeei Q9Y421.
    CleanExi HS_FAM32A.
    Genevestigatori Q9Y421.

    Family and domain databases

    InterProi IPR013865. DUF1754_euk.
    [Graphical view ]
    PANTHERi PTHR13282. PTHR13282. 1 hit.
    Pfami PF08555. DUF1754. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
      Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
      Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Uterus.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain, Lung and Lymph.
    4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    5. "Anti-proliferative and pro-apoptotic actions of a novel human and mouse ovarian tumor-associated gene OTAG-12: downregulation, alternative splicing and drug sensitization."
      Chen X., Zhang H., Aravindakshan J.P., Gotlieb W.H., Sairam M.R.
      Oncogene 30:2874-2887(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING, INDUCTION.

    Entry informationi

    Entry nameiFA32A_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y421
    Secondary accession number(s): Q9BT02
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 7, 2006
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 105 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3