Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glutamate receptor-interacting protein 1

Gene

GRIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons (PubMed:10197531). Through complex formation with NSG1, GRIA2 and STX12 controls the intracellular fate of AMPAR and the endosomal sorting of the GRIA2 subunit toward recycling and membrane targeting (By similarity).By similarity1 Publication

GO - Molecular functioni

  • androgen receptor binding Source: UniProtKB
  • beta-catenin binding Source: AgBase
  • glucocorticoid receptor binding Source: UniProtKB
  • protein C-terminus binding Source: UniProtKB
  • receptor signaling complex scaffold activity Source: UniProtKB
  • transcription coactivator activity Source: UniProtKB

GO - Biological processi

  • androgen receptor signaling pathway Source: UniProtKB
  • dendrite development Source: InterPro
  • intracellular signal transduction Source: UniProtKB
  • positive regulation of neuron projection arborization Source: ARUK-UCL
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • protein localization Source: Ensembl

Enzyme and pathway databases

ReactomeiR-HSA-416993 Trafficking of GluR2-containing AMPA receptors
SignaLinkiQ9Y3R0
SIGNORiQ9Y3R0

Names & Taxonomyi

Protein namesi
Recommended name:
Glutamate receptor-interacting protein 1
Short name:
GRIP-1
Gene namesi
Name:GRIP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000155974.11
HGNCiHGNC:18708 GRIP1
MIMi604597 gene
neXtProtiNX_Q9Y3R0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasmic vesicle, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Involvement in diseasei

Fraser syndrome 3 (FRASRS3)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of Fraser syndrome, an autosomal recessive disorder characterized by cryptophthalmos, cutaneous syndactyly, and urogenital abnormalities including renal agenesis or hypoplasia. Additional features include abnormalities of the larynx, ear malformations, and facial abnormalities.
See also OMIM:617667

Organism-specific databases

DisGeNETi23426
MalaCardsiGRIP1
MIMi617667 phenotype
OpenTargetsiENSG00000155974
Orphaneti2052 Fraser syndrome

Polymorphism and mutation databases

BioMutaiGRIP1
DMDMi313104231

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000838491 – 1128Glutamate receptor-interacting protein 1Add BLAST1128

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei43PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9Y3R0
PeptideAtlasiQ9Y3R0
PRIDEiQ9Y3R0

PTM databases

iPTMnetiQ9Y3R0
PhosphoSitePlusiQ9Y3R0

Expressioni

Gene expression databases

BgeeiENSG00000155974
CleanExiHS_GRIP1
ExpressionAtlasiQ9Y3R0 baseline and differential
GenevisibleiQ9Y3R0 HS

Organism-specific databases

HPAiHPA038856

Interactioni

Subunit structurei

Interacts with EPHA7, EPHB2, KIF5A, KIF5B, KIF5C, GRIA2, GRIA3, GRIPAP1/GRASP1, PPFIA1, PPFIA4, FRAS1, PLCD4, PTPRF and liprins-alpha. Can form homomultimers or heteromultimers with GRIP2. Forms a ternary complex with GRIA2 and CSPG4 (By similarity). Interacts with ATAD1 in an ATP-dependent manner. ATAD1-catalyzed ATP hydrolysis disrupts binding to ATAD1 and to GRIA2 and leads to AMPAR complex disassembly (By similarity). Interacts with EFNB1, EFNB3 and the C-terminal tail of PRLHR. Interacts with SLC30A9 (By similarity). Interacts with BUD23. Forms a complex with NSG1, GRIA2 and STX12; controls the intracellular fate of AMPAR and the endosomal sorting of the GRIA2 subunit toward recycling and membrane targeting. Interacts with NSG1 (By similarity).By similarity3 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • androgen receptor binding Source: UniProtKB
  • beta-catenin binding Source: AgBase
  • glucocorticoid receptor binding Source: UniProtKB
  • protein C-terminus binding Source: UniProtKB
  • receptor signaling complex scaffold activity Source: UniProtKB

Protein-protein interaction databases

BioGridi116995, 44 interactors
CORUMiQ9Y3R0
IntActiQ9Y3R0, 21 interactors
MINTiQ9Y3R0
STRINGi9606.ENSP00000381098

Structurei

Secondary structure

11128
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi148 – 156Combined sources9
Beta strandi163 – 169Combined sources7
Beta strandi178 – 185Combined sources8
Helixi190 – 194Combined sources5
Beta strandi202 – 206Combined sources5
Helixi216 – 225Combined sources10
Beta strandi228 – 237Combined sources10

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JILX-ray1.50A/B149-239[»]
ProteinModelPortaliQ9Y3R0
SMRiQ9Y3R0
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9Y3R0

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini53 – 136PDZ 1PROSITE-ProRule annotationAdd BLAST84
Domaini150 – 238PDZ 2PROSITE-ProRule annotationAdd BLAST89
Domaini252 – 336PDZ 3PROSITE-ProRule annotationAdd BLAST85
Domaini472 – 561PDZ 4PROSITE-ProRule annotationAdd BLAST90
Domaini573 – 658PDZ 5PROSITE-ProRule annotationAdd BLAST86
Domaini673 – 755PDZ 6PROSITE-ProRule annotationAdd BLAST83
Domaini1004 – 1086PDZ 7PROSITE-ProRule annotationAdd BLAST83

Domaini

PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1 and EPHB2 and with the C-terminus of PPFIA1 and PPFIA4. PDZ 4 and PDZ 5 mediate interaction with the C-terminus of GRIA2 and GRIA3. PDZ 4, PDZ 5 and PDZ 6 mediate homomultimers. PDZ 7 mediates interaction with PDZ domain of GRASP1. PDZ 7 domain binds CSPG4. PDZ 6 mediates interaction with the C-terminus of liprins-alpha. PDZ 1, PDZ 2 and PDZ 3 mediate interaction with the PDZ-binding motif of FRAS1 (By similarity). PDZ 4 and PDZ 5 mediate interaction with PRLHR.By similarity

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG3528 Eukaryota
ENOG410XSUX LUCA
GeneTreeiENSGT00760000119017
HOGENOMiHOG000043120
HOVERGENiHBG051841
InParanoidiQ9Y3R0
KOiK20251
OMAiTMSLNHE
OrthoDBiEOG091G03D1
PhylomeDBiQ9Y3R0
TreeFamiTF326909

Family and domain databases

InterProiView protein in InterPro
IPR030026 GRIP1
IPR001478 PDZ
IPR036034 PDZ_sf
PANTHERiPTHR10316:SF39 PTHR10316:SF39, 1 hit
PfamiView protein in Pfam
PF00595 PDZ, 7 hits
SMARTiView protein in SMART
SM00228 PDZ, 7 hits
SUPFAMiSSF50156 SSF50156, 7 hits
PROSITEiView protein in PROSITE
PS50106 PDZ, 7 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y3R0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIAVSFKCRC QILRRLTKDE SPYTKSASQT KPPDGALAVR RQSIPEEFKG
60 70 80 90 100
STVVELMKKE GTTLGLTVSG GIDKDGKPRV SNLRQGGIAA RSDQLDVGDY
110 120 130 140 150
IKAVNGINLA KFRHDEIISL LKNVGERVVL EVEYELPPVS VQGSSVIFRT
160 170 180 190 200
VEVTLHKEGN TFGFVIRGGA HDDRNKSRPV VITCVRPGGP ADREGTIKPG
210 220 230 240 250
DRLLSVDGIR LLGTTHAEAM SILKQCGQEA ALLIEYDVSV MDSVATASGP
260 270 280 290 300
LLVEVAKTPG ASLGVALTTS MCCNKQVIVI DKIKSASIAD RCGALHVGDH
310 320 330 340 350
ILSIDGTSME YCTLAEATQF LANTTDQVKL EILPHHQTRL ALKGPDHVKI
360 370 380 390 400
QRSDRQLTWD SWASNHSSLH TNHHYNTYHP DHCRVPALTF PKAPPPNSPP
410 420 430 440 450
ALVSSSFSPT SMSAYSLSSL NMGTLPRSLY STSPRGTMMR RRLKKKDFKS
460 470 480 490 500
SLSLASSTVG LAGQVVHTET TEVVLTADPV TGFGIQLQGS VFATETLSSP
510 520 530 540 550
PLISYIEADS PAERCGVLQI GDRVMAINGI PTEDSTFEEA SQLLRDSSIT
560 570 580 590 600
SKVTLEIEFD VAESVIPSSG TFHVKLPKKH NVELGITISS PSSRKPGDPL
610 620 630 640 650
VISDIKKGSV AHRTGTLELG DKLLAIDNIR LDNCSMEDAV QILQQCEDLV
660 670 680 690 700
KLKIRKDEDN SDEQESSGAI IYTVELKRYG GPLGITISGT EEPFDPIIIS
710 720 730 740 750
SLTKGGLAER TGAIHIGDRI LAINSSSLKG KPLSEAIHLL QMAGETVTLK
760 770 780 790 800
IKKQTDAQSA SSPKKFPISS HLSDLGDVEE DSSPAQKPGK LSDMYPSTVP
810 820 830 840 850
SVDSAVDSWD GSAIDTSYGT QGTSFQASGY NFNTYDWRSP KQRGSLSPVT
860 870 880 890 900
KPRSQTYPDV GLSYEDWDRS TASGFAGAAD SAETEQEENF WSQALEDLET
910 920 930 940 950
CGQSGILREL EEKADRRVSL RNMTLLATIM SGSTMSLNHE APTPRSQLGR
960 970 980 990 1000
QASFQERSSS RPHYSQTTRS NTLPSDVGRK SVTLRKMKQE IKEIMSPTPV
1010 1020 1030 1040 1050
ELHKVTLYKD SDMEDFGFSV ADGLLEKGVY VKNIRPAGPG DLGGLKPYDR
1060 1070 1080 1090 1100
LLQVNHVRTR DFDCCLVVPL IAESGNKLDL VISRNPLASQ KSIDQQSLPG
1110 1120
DWSEQNSAFF QQPSHGGNLE TREPTNTL
Length:1,128
Mass (Da):122,422
Last modified:November 30, 2010 - v3
Checksum:iD97B96ADF2C3796B
GO
Isoform 2 (identifier: Q9Y3R0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     912-926: Missing.

Note: No experimental confirmation available.
Show »
Length:1,113
Mass (Da):120,638
Checksum:i238CCE7D74B02257
GO
Isoform 3 (identifier: Q9Y3R0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     348-400: VKIQRSDRQLTWDSWASNHSSLHTNHHYNTYHPDHCRVPALTFPKAPPPNSPP → A

Show »
Length:1,076
Mass (Da):116,371
Checksum:iE5A5A1C1EAD662C6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti821Q → E in AAI15394 (PubMed:15489334).Curated1
Sequence conflicti821Q → E in CAB39895 (PubMed:10197531).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_056904322A → T. Corresponds to variant dbSNP:rs17102531Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_040281348 – 400VKIQR…PNSPP → A in isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_009743912 – 926Missing in isoform 2. 1 PublicationAdd BLAST15

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC078889 Genomic DNA No translation available.
AC090710 Genomic DNA No translation available.
AC122686 Genomic DNA No translation available.
AC135251 Genomic DNA No translation available.
BC115393 mRNA Translation: AAI15394.1
BC115394 mRNA Translation: AAI15395.1
AJ133439 mRNA Translation: CAB39895.1
CCDSiCCDS41807.1 [Q9Y3R0-3]
RefSeqiNP_001171545.1, NM_001178074.1
NP_066973.2, NM_021150.3 [Q9Y3R0-3]
XP_011536395.1, XM_011538093.2 [Q9Y3R0-1]
UniGeneiHs.505946

Genome annotation databases

EnsembliENST00000359742; ENSP00000352780; ENSG00000155974 [Q9Y3R0-1]
ENST00000398016; ENSP00000381098; ENSG00000155974 [Q9Y3R0-3]
GeneIDi23426
KEGGihsa:23426
UCSCiuc001stk.4 human [Q9Y3R0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiGRIP1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y3R0
Secondary accession number(s): C9JT59, Q1RLM0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: November 30, 2010
Last modified: March 28, 2018
This is version 151 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health