Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane emp24 domain-containing protein 3

Gene

TMED3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Potential role in vesicular protein trafficking, mainly in the early secretory pathway. Contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network.1 Publication

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Enzyme and pathway databases

BioCyciZFISH:ENSG00000166557-MONOMER.
ReactomeiR-HSA-6807878. COPI-mediated anterograde transport.
R-HSA-6811434. COPI-dependent Golgi-to-ER retrograde traffic.

Protein family/group databases

TCDBi9.B.188.1.3. the transmembrane emp24 domain-containing protein (tmed) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane emp24 domain-containing protein 3
Alternative name(s):
Membrane protein p24B
p24 family protein gamma-4
Short name:
p24gamma4
p26
Gene namesi
Name:TMED3
Synonyms:C15orf22
ORF Names:UNQ5357/PRO1078
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:28889. TMED3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini24 – 180LumenalSequence analysisAdd BLAST157
Transmembranei181 – 201HelicalSequence analysisAdd BLAST21
Topological domaini202 – 217CytoplasmicSequence analysisAdd BLAST16

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasmic vesicle, Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi23423.
OpenTargetsiENSG00000166557.
PharmGKBiPA134958958.

Polymorphism and mutation databases

BioMutaiTMED3.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000001038424 – 217Transmembrane emp24 domain-containing protein 3Add BLAST194

Proteomic databases

EPDiQ9Y3Q3.
PaxDbiQ9Y3Q3.
PeptideAtlasiQ9Y3Q3.
PRIDEiQ9Y3Q3.

PTM databases

iPTMnetiQ9Y3Q3.
PhosphoSitePlusiQ9Y3Q3.

Expressioni

Gene expression databases

BgeeiENSG00000166557.
CleanExiHS_TMED3.
ExpressionAtlasiQ9Y3Q3. baseline and differential.
GenevisibleiQ9Y3Q3. HS.

Organism-specific databases

HPAiHPA049314.

Interactioni

Subunit structurei

Monomer in endoplasmic reticulum, endoplasmic reticulum-Golgi intermediate compartment and cis-Golgi network. Interacts (via C-terminus) with COPG1; the interaction involves dimeric TMED3; however, there are conflicting reports on the interaction. Interacts with GORASP1 and GORASP2 (By similarity).By similarity

Protein-protein interaction databases

BioGridi116993. 16 interactors.
IntActiQ9Y3Q3. 3 interactors.
STRINGi9606.ENSP00000299705.

Structurei

3D structure databases

ProteinModelPortaliQ9Y3Q3.
SMRiQ9Y3Q3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini38 – 120GOLDPROSITE-ProRule annotationAdd BLAST83

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi204 – 217COPI vesicle coat-bindingSequence analysisAdd BLAST14
Motifi204 – 205COPII vesicle coat-bindingSequence analysis2

Sequence similaritiesi

Belongs to the EMP24/GP25L family.Curated
Contains 1 GOLD domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1693. Eukaryota.
ENOG4111JPD. LUCA.
GeneTreeiENSGT00670000097656.
HOGENOMiHOG000160229.
HOVERGENiHBG000271.
InParanoidiQ9Y3Q3.
KOiK20350.
OMAiGRVSYWS.
OrthoDBiEOG091G0LX8.
PhylomeDBiQ9Y3Q3.
TreeFamiTF313000.

Family and domain databases

Gene3Di3.10.180.10. 1 hit.
InterProiIPR029068. Glyas_Bleomycin-R_OHBP_Dase.
IPR009038. GOLD_dom.
IPR015720. TMP21-related.
[Graphical view]
PANTHERiPTHR22811. PTHR22811. 1 hit.
PfamiPF01105. EMP24_GP25L. 1 hit.
[Graphical view]
SMARTiSM01190. EMP24_GP25L. 1 hit.
[Graphical view]
SUPFAMiSSF101576. SSF101576. 1 hit.
PROSITEiPS50866. GOLD. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y3Q3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSTVPRSAS VLLLLLLLRR AEQPCGAELT FELPDNAKQC FHEEVEQGVK
60 70 80 90 100
FSLDYQVITG GHYDVDCYVE DPQGNTIYRE TKKQYDSFTY RAEVKGVYQF
110 120 130 140 150
CFSNEFSTFS HKTVYFDFQV GDEPPILPDM GNRVTALTQM ESACVTIHEA
160 170 180 190 200
LKTVIDSQTH YRLREAQDRA RAEDLNSRVS YWSVGETIAL FVVSFSQVLL
210
LKSFFTEKRP ISRAVHS
Length:217
Mass (Da):24,777
Last modified:November 1, 1999 - v1
Checksum:i515C3F0B6C17EBDD
GO
Isoform 2 (identifier: Q9Y3Q3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     140-216: MESACVTIHE...EKRPISRAVH → RFRGAYWKEVDKMVDYMQPGGTPATEGLGRLAP

Show »
Length:173
Mass (Da):19,635
Checksum:i19B2AA92EC6F57B3
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04911086D → N.Corresponds to variant rs3784543dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044371140 – 216MESAC…SRAVH → RFRGAYWKEVDKMVDYMQPG GTPATEGLGRLAP in isoform 2. 1 PublicationAdd BLAST77

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ132270 mRNA. Translation: CAB40416.1.
AL109672 mRNA. Translation: CAB52017.1.
AY358974 mRNA. Translation: AAQ89333.1.
CR457384 mRNA. Translation: CAG33665.1.
AK289434 mRNA. Translation: BAF82123.1.
AK297710 mRNA. Translation: BAG60067.1.
AC011797 Genomic DNA. No translation available.
AC027811 Genomic DNA. No translation available.
BC000027 mRNA. Translation: AAH00027.1.
BC010853 mRNA. Translation: AAH10853.1.
BC017495 mRNA. Translation: AAH17495.1.
BC022232 mRNA. Translation: AAH22232.1.
BC111547 mRNA. Translation: AAI11548.1.
CCDSiCCDS10310.1. [Q9Y3Q3-1]
CCDS81914.1. [Q9Y3Q3-2]
RefSeqiNP_001317305.1. NM_001330376.1.
NP_031390.1. NM_007364.3. [Q9Y3Q3-1]
UniGeneiHs.513058.
Hs.665470.
Hs.71608.

Genome annotation databases

EnsembliENST00000299705; ENSP00000299705; ENSG00000166557. [Q9Y3Q3-1]
ENST00000424155; ENSP00000414983; ENSG00000166557. [Q9Y3Q3-2]
GeneIDi23423.
KEGGihsa:23423.
UCSCiuc002beu.4. human. [Q9Y3Q3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ132270 mRNA. Translation: CAB40416.1.
AL109672 mRNA. Translation: CAB52017.1.
AY358974 mRNA. Translation: AAQ89333.1.
CR457384 mRNA. Translation: CAG33665.1.
AK289434 mRNA. Translation: BAF82123.1.
AK297710 mRNA. Translation: BAG60067.1.
AC011797 Genomic DNA. No translation available.
AC027811 Genomic DNA. No translation available.
BC000027 mRNA. Translation: AAH00027.1.
BC010853 mRNA. Translation: AAH10853.1.
BC017495 mRNA. Translation: AAH17495.1.
BC022232 mRNA. Translation: AAH22232.1.
BC111547 mRNA. Translation: AAI11548.1.
CCDSiCCDS10310.1. [Q9Y3Q3-1]
CCDS81914.1. [Q9Y3Q3-2]
RefSeqiNP_001317305.1. NM_001330376.1.
NP_031390.1. NM_007364.3. [Q9Y3Q3-1]
UniGeneiHs.513058.
Hs.665470.
Hs.71608.

3D structure databases

ProteinModelPortaliQ9Y3Q3.
SMRiQ9Y3Q3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116993. 16 interactors.
IntActiQ9Y3Q3. 3 interactors.
STRINGi9606.ENSP00000299705.

Protein family/group databases

TCDBi9.B.188.1.3. the transmembrane emp24 domain-containing protein (tmed) family.

PTM databases

iPTMnetiQ9Y3Q3.
PhosphoSitePlusiQ9Y3Q3.

Polymorphism and mutation databases

BioMutaiTMED3.

Proteomic databases

EPDiQ9Y3Q3.
PaxDbiQ9Y3Q3.
PeptideAtlasiQ9Y3Q3.
PRIDEiQ9Y3Q3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000299705; ENSP00000299705; ENSG00000166557. [Q9Y3Q3-1]
ENST00000424155; ENSP00000414983; ENSG00000166557. [Q9Y3Q3-2]
GeneIDi23423.
KEGGihsa:23423.
UCSCiuc002beu.4. human. [Q9Y3Q3-1]

Organism-specific databases

CTDi23423.
DisGeNETi23423.
GeneCardsiTMED3.
HGNCiHGNC:28889. TMED3.
HPAiHPA049314.
neXtProtiNX_Q9Y3Q3.
OpenTargetsiENSG00000166557.
PharmGKBiPA134958958.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1693. Eukaryota.
ENOG4111JPD. LUCA.
GeneTreeiENSGT00670000097656.
HOGENOMiHOG000160229.
HOVERGENiHBG000271.
InParanoidiQ9Y3Q3.
KOiK20350.
OMAiGRVSYWS.
OrthoDBiEOG091G0LX8.
PhylomeDBiQ9Y3Q3.
TreeFamiTF313000.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000166557-MONOMER.
ReactomeiR-HSA-6807878. COPI-mediated anterograde transport.
R-HSA-6811434. COPI-dependent Golgi-to-ER retrograde traffic.

Miscellaneous databases

ChiTaRSiTMED3. human.
GenomeRNAii23423.
PROiQ9Y3Q3.

Gene expression databases

BgeeiENSG00000166557.
CleanExiHS_TMED3.
ExpressionAtlasiQ9Y3Q3. baseline and differential.
GenevisibleiQ9Y3Q3. HS.

Family and domain databases

Gene3Di3.10.180.10. 1 hit.
InterProiIPR029068. Glyas_Bleomycin-R_OHBP_Dase.
IPR009038. GOLD_dom.
IPR015720. TMP21-related.
[Graphical view]
PANTHERiPTHR22811. PTHR22811. 1 hit.
PfamiPF01105. EMP24_GP25L. 1 hit.
[Graphical view]
SMARTiSM01190. EMP24_GP25L. 1 hit.
[Graphical view]
SUPFAMiSSF101576. SSF101576. 1 hit.
PROSITEiPS50866. GOLD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTMED3_HUMAN
AccessioniPrimary (citable) accession number: Q9Y3Q3
Secondary accession number(s): A8K069, B4DN05, Q2T9F8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2002
Last sequence update: November 1, 1999
Last modified: November 30, 2016
This is version 141 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.