Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Y3P9 (RBGP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 113. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Rab GTPase-activating protein 1
Alternative name(s):
GAP and centrosome-associated protein
Rab6 GTPase-activating protein GAPCenA
Gene names
Name:RABGAP1
ORF Names:HSPC094
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1069 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May act as a GTPase-activating protein of RAB6A. May play a role in microtubule nucleation by centrosome. May participate in a RAB6A-mediated pathway involved in the metaphase-anaphase transition. Ref.1 Ref.9

Subunit structure

Interacts with RAB6A and tubulin gamma. Ref.1

Subcellular location

Cytoplasmcytosol. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Note: Predominantly cytosolic but also associated with the centrosome. Ref.1

Domain

The arginine and glutamine fingers are critical for the GTPase-activating mechanism, they pull out Rab's 'switch 2' glutamine and insert in Rab's active site By similarity.

Sequence similarities

Contains 1 PID domain.

Contains 1 Rab-GAP TBC domain.

Sequence caution

The sequence AAF28917.1 differs from that shown. Reason: Frameshift at several positions.

The sequence AAH20609.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

The sequence AAH54492.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AK022408 differs from that shown. Reason: Intron retention.

The sequence CAB40267.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Ontologies

Binary interactions

With

Entry

#Exp.

IntAct

Notes

GABARAPL1Q9H0R82EBI-1057545,EBI-746969

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 Ref.1 (identifier: Q9Y3P9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 Ref.4 (identifier: Q9Y3P9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.
     637-667: AYSVYDEEIGYCQGQSFLAAVLLLHMPEEQA → VFHVKKKKDSILSGGSTLKLHKKQLQSVICI
     668-1069: Missing.
Note: No experimental confirmation available.
Isoform 3 Ref.2 (identifier: Q9Y3P9-3)

The sequence of this isoform differs from the canonical sequence as follows:
     480-1069: Missing.
Note: No experimental confirmation available.
Isoform 4 Ref.4 (identifier: Q9Y3P9-4)

The sequence of this isoform differs from the canonical sequence as follows:
     258-265: RILYSFAT → PQEKTLCK
     266-1069: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10691069Rab GTPase-activating protein 1
PRO_0000298779

Regions

Domain142 – 298157PID
Domain566 – 752187Rab-GAP TBC
Coiled coil798 – 1047250 Potential

Sites

Site6081Arginine finger By similarity
Site6491Glutamine finger By similarity

Amino acid modifications

Modified residue9961Phosphothreonine Ref.10

Natural variations

Alternative sequence1 – 6868Missing in isoform 2. Ref.4
VSP_052510
Alternative sequence258 – 2658RILYSFAT → PQEKTLCK in isoform 4. Ref.4
VSP_052511
Alternative sequence266 – 1069804Missing in isoform 4. Ref.4
VSP_052512
Alternative sequence480 – 1069590Missing in isoform 3. Ref.2
VSP_052515
Alternative sequence637 – 66731AYSVY…PEEQA → VFHVKKKKDSILSGGSTLKL HKKQLQSVICI in isoform 2. Ref.4
VSP_052513
Alternative sequence668 – 1069402Missing in isoform 2. Ref.4
VSP_052514

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified August 21, 2007. Version 3.
Checksum: F3B09BD3CF993F3A

FASTA1,069121,737
        10         20         30         40         50         60 
MDDKASVGKI SVSSDSVSTL NSEDFVLVSR QGDETPSTNN GSDDEKTGLK IVGNGSEQQL 

        70         80         90        100        110        120 
QKELADVLMD PPMDDQPGEK ELVKRSQLDG EGDGPLSNQL SASSTINPVP LVGLQKPEMS 

       130        140        150        160        170        180 
LPVKPGQGDS EASSPFTPVA DEDSVVFSKL TYLGCASVNA PRSEVEALRM MSILRSQCQI 

       190        200        210        220        230        240 
SLDVTLSVPN VSEGIVRLLD PQTNTEIANY PIYKILFCVR GHDGTPESDC FAFTESHYNA 

       250        260        270        280        290        300 
ELFRIHVFRC EIQEAVSRIL YSFATAFRRS AKQTPLSATA APQTPDSDIF TFSVSLEIKE 

       310        320        330        340        350        360 
DDGKGYFSAV PKDKDRQCFK LRQGIDKKIV IYVQQTTNKE LAIERCFGLL LSPGKDVRNS 

       370        380        390        400        410        420 
DMHLLDLESM GKSSDGKSYV ITGSWNPKSP HFQVVNEETP KDKVLFMTTA VDLVITEVQE 

       430        440        450        460        470        480 
PVRFLLETKV RVCSPNERLF WPFSKRSTTE NFFLKLKQIK QRERKNNTDT LYEVVCLESE 

       490        500        510        520        530        540 
SERERRKTTA SPSVRLPQSG SQSSVIPSPP EDDEEEDNDE PLLSGSGDVS KECAEKILET 

       550        560        570        580        590        600 
WGELLSKWHL NLNVRPKQLS SLVRNGVPEA LRGEVWQLLA GCHNNDHLVE KYRILITKES 

       610        620        630        640        650        660 
PQDSAITRDI NRTFPAHDYF KDTGGDGQDS LYKICKAYSV YDEEIGYCQG QSFLAAVLLL 

       670        680        690        700        710        720 
HMPEEQAFSV LVKIMFDYGL RELFKQNFED LHCKFYQLER LMQEYIPDLY NHFLDISLEA 

       730        740        750        760        770        780 
HMYASQWFLT LFTAKFPLYM VFHIIDLLLC EGISVIFNVA LGLLKTSKDD LLLTDFEGAL 

       790        800        810        820        830        840 
KFFRVQLPKR YRSEENAKKL MELACNMKIS QKKLKKYEKE YHTMREQQAQ QEDPIERFER 

       850        860        870        880        890        900 
ENRRLQEANM RLEQENDDLA HELVTSKIAL RKDLDNAEEK ADALNKELLM TKQKLIDAEE 

       910        920        930        940        950        960 
EKRRLEEESA QLKEMCRREL DKAESEIKKN SSIIGDYKQI CSQLSERLEK QQTANKVEIE 

       970        980        990       1000       1010       1020 
KIRQKVDDCE RCREFFNKEG RVKGISSTKE VLDEDTDEEK ETLKNQLREM ELELAQTKLQ 

      1030       1040       1050       1060 
LVEAECKIQD LEHHLGLALN EVQAAKKTWF NRTLSSIKTA TGVQGKETC 

« Hide

Isoform 2 [UniParc].

Checksum: 549686265A37B8BB
Show »

FASTA59967,098
Isoform 3 [UniParc].

Checksum: 56599C32796E7909
Show »

FASTA47953,195
Isoform 4 [UniParc].

Checksum: 7BA5E80C1D8A71FF
Show »

FASTA26528,712

References

« Hide 'large scale' references
[1]"Characterization of GAPCenA, a GTPase activating protein for Rab6, part of which associates with the centrosome."
Cuif M.-H., Possmayer F., Zander H., Bordes N., Jollivet F., Couedel-Courteille A., Janoueix-Lerosey I., Langsley G., Bornens M., Goud B.
EMBO J. 18:1772-1782(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH RAB6A AND TUBULIN GAMMA, SUBCELLULAR LOCATION.
Tissue: Placenta.
[2]"Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity."
Ishibashi K., Kanno E., Itoh T., Fukuda M.
Genes Cells 14:41-52(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Tissue: Brain.
[3]"Human partial CDS from CD34+ stem cells."
Zhang Q.H., Ye M., Zhou J., Shen Y., Wu X.Y., Guan Z.Q., Wang L., Fan H.Y., Mao Y.F., Dai M., Huang Q.H., Chen S.J., Chen Z.
Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Umbilical cord blood.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
Tissue: Mammary gland and Testis.
[5]"DNA sequence and analysis of human chromosome 9."
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. expand/collapse author list , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Placenta and Uterus.
[8]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 824-1069 (ISOFORM 1).
Tissue: Uterus.
[9]"A role for the Rab6A' GTPase in the inactivation of the Mad2-spindle checkpoint."
Miserey-Lenkei S., Couedel-Courteille A., Del Nery E., Bardin S., Piel M., Racine V., Sibarita J.-B., Perez F., Bornens M., Goud B.
EMBO J. 25:278-289(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[10]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-996, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[11]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ011679 mRNA. Translation: CAB40267.2. Different initiation.
AB449897 mRNA. Translation: BAH16640.1.
AF161357 mRNA. Translation: AAF28917.1. Frameshift.
AK022408 mRNA. No translation available.
AK131449 mRNA. Translation: BAD18594.1.
AL365338, AC007066 Genomic DNA. Translation: CAH70298.2.
CH471090 Genomic DNA. Translation: EAW87555.1.
BC020609 mRNA. Translation: AAH20609.1. Sequence problems.
BC054492 mRNA. Translation: AAH54492.1. Different initiation.
AL050195 mRNA. Translation: CAB43313.1.
PIRT13163.
RefSeqNP_036329.3. NM_012197.3.
XP_005251923.1. XM_005251866.1.
UniGeneHs.271341.

3D structure databases

ProteinModelPortalQ9Y3P9.
SMRQ9Y3P9. Positions 143-269, 538-825.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid117166. 15 interactions.
IntActQ9Y3P9. 13 interactions.
MINTMINT-258769.
STRING9606.ENSP00000362751.

PTM databases

PhosphoSiteQ9Y3P9.

Polymorphism databases

DMDM156633605.

Proteomic databases

PaxDbQ9Y3P9.
PRIDEQ9Y3P9.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000373647; ENSP00000362751; ENSG00000011454. [Q9Y3P9-1]
ENST00000456584; ENSP00000414386; ENSG00000011454. [Q9Y3P9-2]
GeneID23637.
KEGGhsa:23637.
UCSCuc004bnm.1. human. [Q9Y3P9-4]
uc011lzh.2. human. [Q9Y3P9-1]

Organism-specific databases

CTD23637.
GeneCardsGC09P125703.
H-InvDBHIX0008361.
HGNCHGNC:17155. RABGAP1.
neXtProtNX_Q9Y3P9.
PharmGKBPA134977298.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5210.
HOGENOMHOG000007923.
HOVERGENHBG063892.
InParanoidQ9Y3P9.
OMAMIPSPPE.
OrthoDBEOG751NDS.
PhylomeDBQ9Y3P9.
TreeFamTF317184.

Gene expression databases

ArrayExpressQ9Y3P9.
BgeeQ9Y3P9.
CleanExHS_RABGAP1.
GenevestigatorQ9Y3P9.

Family and domain databases

Gene3D1.10.10.60. 1 hit.
2.30.29.30. 1 hit.
InterProIPR009057. Homeodomain-like.
IPR022164. Kinesin-like.
IPR011993. PH_like_dom.
IPR006020. PTB/PI_dom.
IPR000195. Rab-GTPase-TBC_dom.
[Graphical view]
PfamPF12473. DUF3694. 1 hit.
PF00640. PID. 1 hit.
PF00566. RabGAP-TBC. 1 hit.
[Graphical view]
SMARTSM00462. PTB. 1 hit.
SM00164. TBC. 1 hit.
[Graphical view]
SUPFAMSSF47923. SSF47923. 2 hits.
PROSITEPS01179. PID. 1 hit.
PS50086. TBC_RABGAP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSRABGAP1. human.
GeneWikiRABGAP1.
GenomeRNAi23637.
NextBio46429.
PROQ9Y3P9.

Entry information

Entry nameRBGP1_HUMAN
AccessionPrimary (citable) accession number: Q9Y3P9
Secondary accession number(s): B9A6L2 expand/collapse secondary AC list , Q05CW2, Q6ZMY1, Q9HA28, Q9P0E2, Q9UG67
Entry history
Integrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: August 21, 2007
Last modified: April 16, 2014
This is version 113 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM