Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rab GTPase-activating protein 1

Gene

RABGAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May act as a GTPase-activating protein of RAB6A. May play a role in microtubule nucleation by centrosome. May participate in a RAB6A-mediated pathway involved in the metaphase-anaphase transition.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei608Arginine fingerBy similarity1
Sitei649Glutamine fingerBy similarity1

GO - Molecular functioni

  • DNA binding Source: InterPro
  • GTPase activator activity Source: UniProtKB
  • Rab GTPase binding Source: UniProtKB
  • tubulin binding Source: ProtInc

GO - Biological processi

  • activation of GTPase activity Source: GO_Central
  • cell cycle Source: ProtInc
  • intracellular protein transport Source: GO_Central
  • regulation of vesicle fusion Source: GO_Central
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Keywords - Biological processi

Cell cycle

Enzyme and pathway databases

BioCyciZFISH:ENSG00000011454-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Rab GTPase-activating protein 1
Alternative name(s):
GAP and centrosome-associated protein
Rab6 GTPase-activating protein GAPCenA
Gene namesi
Name:RABGAP1
ORF Names:HSPC094
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:17155. RABGAP1.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: ProtInc
  • cytosol Source: UniProtKB
  • endomembrane system Source: GO_Central
  • microtubule associated complex Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi23637.
OpenTargetsiENSG00000011454.
PharmGKBiPA134977298.

Polymorphism and mutation databases

BioMutaiRABGAP1.
DMDMi156633605.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002987791 – 1069Rab GTPase-activating protein 1Add BLAST1069

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei42PhosphoserineCombined sources1
Modified residuei360PhosphoserineBy similarity1
Modified residuei996PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9Y3P9.
PaxDbiQ9Y3P9.
PeptideAtlasiQ9Y3P9.
PRIDEiQ9Y3P9.

PTM databases

iPTMnetiQ9Y3P9.
PhosphoSitePlusiQ9Y3P9.

Expressioni

Gene expression databases

BgeeiENSG00000011454.
CleanExiHS_RABGAP1.
ExpressionAtlasiQ9Y3P9. baseline and differential.
GenevisibleiQ9Y3P9. HS.

Organism-specific databases

HPAiHPA064860.

Interactioni

Subunit structurei

Interacts with RAB6A and tubulin gamma.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
GABARAPL1Q9H0R82EBI-1057545,EBI-746969

GO - Molecular functioni

  • Rab GTPase binding Source: UniProtKB
  • tubulin binding Source: ProtInc

Protein-protein interaction databases

BioGridi117166. 37 interactors.
IntActiQ9Y3P9. 15 interactors.
MINTiMINT-258769.
STRINGi9606.ENSP00000362751.

Structurei

Secondary structure

11069
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi540 – 549Combined sources10
Helixi559 – 564Combined sources6
Helixi569 – 571Combined sources3
Helixi572 – 580Combined sources9
Helixi586 – 595Combined sources10
Helixi603 – 611Combined sources9
Turni618 – 620Combined sources3
Helixi626 – 641Combined sources16
Turni643 – 645Combined sources3
Helixi651 – 659Combined sources9
Helixi664 – 675Combined sources12
Helixi680 – 684Combined sources5
Helixi686 – 688Combined sources3
Helixi689 – 705Combined sources17
Helixi707 – 715Combined sources9
Helixi720 – 722Combined sources3
Helixi725 – 730Combined sources6
Turni731 – 735Combined sources5
Helixi738 – 751Combined sources14
Helixi755 – 766Combined sources12
Helixi768 – 770Combined sources3
Turni771 – 773Combined sources3
Helixi776 – 784Combined sources9
Helixi786 – 790Combined sources5
Helixi794 – 806Combined sources13
Helixi811 – 828Combined sources18

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4NC6X-ray1.80A536-849[»]
ProteinModelPortaliQ9Y3P9.
SMRiQ9Y3P9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini142 – 298PIDPROSITE-ProRule annotationAdd BLAST157
Domaini566 – 752Rab-GAP TBCPROSITE-ProRule annotationAdd BLAST187

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili798 – 1047Sequence analysisAdd BLAST250

Domaini

The arginine and glutamine fingers are critical for the GTPase-activating mechanism, they pull out Rab's 'switch 2' glutamine and insert in Rab's active site.By similarity

Sequence similaritiesi

Contains 1 PID domain.PROSITE-ProRule annotation
Contains 1 Rab-GAP TBC domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG1102. Eukaryota.
COG5210. LUCA.
GeneTreeiENSGT00750000117238.
HOGENOMiHOG000007923.
HOVERGENiHBG063892.
InParanoidiQ9Y3P9.
KOiK20284.
OrthoDBiEOG091G0AIH.
PhylomeDBiQ9Y3P9.
TreeFamiTF317184.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR009057. Homeodomain-like.
IPR022164. Kinesin-like.
IPR011993. PH_dom-like.
IPR006020. PTB/PI_dom.
IPR000195. Rab-GTPase-TBC_dom.
IPR033185. RabGAP1.
[Graphical view]
PANTHERiPTHR22957:SF208. PTHR22957:SF208. 1 hit.
PfamiPF12473. DUF3694. 1 hit.
PF00640. PID. 1 hit.
PF00566. RabGAP-TBC. 1 hit.
[Graphical view]
SMARTiSM00462. PTB. 1 hit.
SM00164. TBC. 1 hit.
[Graphical view]
SUPFAMiSSF47923. SSF47923. 2 hits.
SSF50729. SSF50729. 1 hit.
PROSITEiPS01179. PID. 1 hit.
PS50086. TBC_RABGAP. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q9Y3P9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDDKASVGKI SVSSDSVSTL NSEDFVLVSR QGDETPSTNN GSDDEKTGLK
60 70 80 90 100
IVGNGSEQQL QKELADVLMD PPMDDQPGEK ELVKRSQLDG EGDGPLSNQL
110 120 130 140 150
SASSTINPVP LVGLQKPEMS LPVKPGQGDS EASSPFTPVA DEDSVVFSKL
160 170 180 190 200
TYLGCASVNA PRSEVEALRM MSILRSQCQI SLDVTLSVPN VSEGIVRLLD
210 220 230 240 250
PQTNTEIANY PIYKILFCVR GHDGTPESDC FAFTESHYNA ELFRIHVFRC
260 270 280 290 300
EIQEAVSRIL YSFATAFRRS AKQTPLSATA APQTPDSDIF TFSVSLEIKE
310 320 330 340 350
DDGKGYFSAV PKDKDRQCFK LRQGIDKKIV IYVQQTTNKE LAIERCFGLL
360 370 380 390 400
LSPGKDVRNS DMHLLDLESM GKSSDGKSYV ITGSWNPKSP HFQVVNEETP
410 420 430 440 450
KDKVLFMTTA VDLVITEVQE PVRFLLETKV RVCSPNERLF WPFSKRSTTE
460 470 480 490 500
NFFLKLKQIK QRERKNNTDT LYEVVCLESE SERERRKTTA SPSVRLPQSG
510 520 530 540 550
SQSSVIPSPP EDDEEEDNDE PLLSGSGDVS KECAEKILET WGELLSKWHL
560 570 580 590 600
NLNVRPKQLS SLVRNGVPEA LRGEVWQLLA GCHNNDHLVE KYRILITKES
610 620 630 640 650
PQDSAITRDI NRTFPAHDYF KDTGGDGQDS LYKICKAYSV YDEEIGYCQG
660 670 680 690 700
QSFLAAVLLL HMPEEQAFSV LVKIMFDYGL RELFKQNFED LHCKFYQLER
710 720 730 740 750
LMQEYIPDLY NHFLDISLEA HMYASQWFLT LFTAKFPLYM VFHIIDLLLC
760 770 780 790 800
EGISVIFNVA LGLLKTSKDD LLLTDFEGAL KFFRVQLPKR YRSEENAKKL
810 820 830 840 850
MELACNMKIS QKKLKKYEKE YHTMREQQAQ QEDPIERFER ENRRLQEANM
860 870 880 890 900
RLEQENDDLA HELVTSKIAL RKDLDNAEEK ADALNKELLM TKQKLIDAEE
910 920 930 940 950
EKRRLEEESA QLKEMCRREL DKAESEIKKN SSIIGDYKQI CSQLSERLEK
960 970 980 990 1000
QQTANKVEIE KIRQKVDDCE RCREFFNKEG RVKGISSTKE VLDEDTDEEK
1010 1020 1030 1040 1050
ETLKNQLREM ELELAQTKLQ LVEAECKIQD LEHHLGLALN EVQAAKKTWF
1060
NRTLSSIKTA TGVQGKETC
Length:1,069
Mass (Da):121,737
Last modified:August 21, 2007 - v3
Checksum:iF3B09BD3CF993F3A
GO
Isoform 21 Publication (identifier: Q9Y3P9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.
     637-667: AYSVYDEEIGYCQGQSFLAAVLLLHMPEEQA → VFHVKKKKDSILSGGSTLKLHKKQLQSVICI
     668-1069: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:599
Mass (Da):67,098
Checksum:i549686265A37B8BB
GO
Isoform 3 (identifier: Q9Y3P9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     480-1069: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:479
Mass (Da):53,195
Checksum:i56599C32796E7909
GO
Isoform 41 Publication (identifier: Q9Y3P9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     258-265: RILYSFAT → PQEKTLCK
     266-1069: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:265
Mass (Da):28,712
Checksum:i7BA5E80C1D8A71FF
GO

Sequence cautioni

The sequence AAF28917 differs from that shown. Reason: Frameshift at several positions.Curated
The sequence AAH20609 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH54492 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AK022408 differs from that shown. Intron retention.Curated
The sequence CAB40267 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0525101 – 68Missing in isoform 2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_052511258 – 265RILYSFAT → PQEKTLCK in isoform 4. 1 Publication8
Alternative sequenceiVSP_052512266 – 1069Missing in isoform 4. 1 PublicationAdd BLAST804
Alternative sequenceiVSP_052515480 – 1069Missing in isoform 3. 1 PublicationAdd BLAST590
Alternative sequenceiVSP_052513637 – 667AYSVY…PEEQA → VFHVKKKKDSILSGGSTLKL HKKQLQSVICI in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_052514668 – 1069Missing in isoform 2. 1 PublicationAdd BLAST402

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ011679 mRNA. Translation: CAB40267.2. Different initiation.
AB449897 mRNA. Translation: BAH16640.1.
AF161357 mRNA. Translation: AAF28917.1. Frameshift.
AK022408 mRNA. No translation available.
AK131449 mRNA. Translation: BAD18594.1.
AL365338, AC007066 Genomic DNA. Translation: CAH70298.2.
CH471090 Genomic DNA. Translation: EAW87555.1.
BC020609 mRNA. Translation: AAH20609.1. Sequence problems.
BC054492 mRNA. Translation: AAH54492.1. Different initiation.
AL050195 mRNA. Translation: CAB43313.1.
CCDSiCCDS6848.2. [Q9Y3P9-1]
PIRiT13163.
RefSeqiNP_036329.3. NM_012197.3. [Q9Y3P9-1]
XP_011516742.1. XM_011518440.2. [Q9Y3P9-1]
XP_011516743.1. XM_011518441.2. [Q9Y3P9-1]
XP_016870056.1. XM_017014567.1. [Q9Y3P9-1]
XP_016870057.1. XM_017014568.1. [Q9Y3P9-1]
XP_016870058.1. XM_017014569.1. [Q9Y3P9-1]
UniGeneiHs.271341.

Genome annotation databases

EnsembliENST00000373647; ENSP00000362751; ENSG00000011454. [Q9Y3P9-1]
ENST00000456584; ENSP00000414386; ENSG00000011454. [Q9Y3P9-2]
GeneIDi23637.
KEGGihsa:23637.
UCSCiuc011lzh.3. human. [Q9Y3P9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ011679 mRNA. Translation: CAB40267.2. Different initiation.
AB449897 mRNA. Translation: BAH16640.1.
AF161357 mRNA. Translation: AAF28917.1. Frameshift.
AK022408 mRNA. No translation available.
AK131449 mRNA. Translation: BAD18594.1.
AL365338, AC007066 Genomic DNA. Translation: CAH70298.2.
CH471090 Genomic DNA. Translation: EAW87555.1.
BC020609 mRNA. Translation: AAH20609.1. Sequence problems.
BC054492 mRNA. Translation: AAH54492.1. Different initiation.
AL050195 mRNA. Translation: CAB43313.1.
CCDSiCCDS6848.2. [Q9Y3P9-1]
PIRiT13163.
RefSeqiNP_036329.3. NM_012197.3. [Q9Y3P9-1]
XP_011516742.1. XM_011518440.2. [Q9Y3P9-1]
XP_011516743.1. XM_011518441.2. [Q9Y3P9-1]
XP_016870056.1. XM_017014567.1. [Q9Y3P9-1]
XP_016870057.1. XM_017014568.1. [Q9Y3P9-1]
XP_016870058.1. XM_017014569.1. [Q9Y3P9-1]
UniGeneiHs.271341.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4NC6X-ray1.80A536-849[»]
ProteinModelPortaliQ9Y3P9.
SMRiQ9Y3P9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117166. 37 interactors.
IntActiQ9Y3P9. 15 interactors.
MINTiMINT-258769.
STRINGi9606.ENSP00000362751.

PTM databases

iPTMnetiQ9Y3P9.
PhosphoSitePlusiQ9Y3P9.

Polymorphism and mutation databases

BioMutaiRABGAP1.
DMDMi156633605.

Proteomic databases

EPDiQ9Y3P9.
PaxDbiQ9Y3P9.
PeptideAtlasiQ9Y3P9.
PRIDEiQ9Y3P9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373647; ENSP00000362751; ENSG00000011454. [Q9Y3P9-1]
ENST00000456584; ENSP00000414386; ENSG00000011454. [Q9Y3P9-2]
GeneIDi23637.
KEGGihsa:23637.
UCSCiuc011lzh.3. human. [Q9Y3P9-1]

Organism-specific databases

CTDi23637.
DisGeNETi23637.
GeneCardsiRABGAP1.
H-InvDBHIX0008361.
HGNCiHGNC:17155. RABGAP1.
HPAiHPA064860.
MIMi615882. gene.
neXtProtiNX_Q9Y3P9.
OpenTargetsiENSG00000011454.
PharmGKBiPA134977298.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1102. Eukaryota.
COG5210. LUCA.
GeneTreeiENSGT00750000117238.
HOGENOMiHOG000007923.
HOVERGENiHBG063892.
InParanoidiQ9Y3P9.
KOiK20284.
OrthoDBiEOG091G0AIH.
PhylomeDBiQ9Y3P9.
TreeFamiTF317184.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000011454-MONOMER.

Miscellaneous databases

ChiTaRSiRABGAP1. human.
GeneWikiiRABGAP1.
GenomeRNAii23637.
PROiQ9Y3P9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000011454.
CleanExiHS_RABGAP1.
ExpressionAtlasiQ9Y3P9. baseline and differential.
GenevisibleiQ9Y3P9. HS.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR009057. Homeodomain-like.
IPR022164. Kinesin-like.
IPR011993. PH_dom-like.
IPR006020. PTB/PI_dom.
IPR000195. Rab-GTPase-TBC_dom.
IPR033185. RabGAP1.
[Graphical view]
PANTHERiPTHR22957:SF208. PTHR22957:SF208. 1 hit.
PfamiPF12473. DUF3694. 1 hit.
PF00640. PID. 1 hit.
PF00566. RabGAP-TBC. 1 hit.
[Graphical view]
SMARTiSM00462. PTB. 1 hit.
SM00164. TBC. 1 hit.
[Graphical view]
SUPFAMiSSF47923. SSF47923. 2 hits.
SSF50729. SSF50729. 1 hit.
PROSITEiPS01179. PID. 1 hit.
PS50086. TBC_RABGAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRBGP1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y3P9
Secondary accession number(s): B9A6L2
, Q05CW2, Q6ZMY1, Q9HA28, Q9P0E2, Q9UG67
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: August 21, 2007
Last modified: November 2, 2016
This is version 138 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.