SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Y3P9

- RBGP1_HUMAN

UniProt

Q9Y3P9 - RBGP1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Rab GTPase-activating protein 1

Gene
RABGAP1, HSPC094
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May act as a GTPase-activating protein of RAB6A. May play a role in microtubule nucleation by centrosome. May participate in a RAB6A-mediated pathway involved in the metaphase-anaphase transition.2 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei608 – 6081Arginine finger By similarity
Sitei649 – 6491Glutamine finger By similarity

GO - Molecular functioni

  1. DNA binding Source: InterPro
  2. GTPase activator activity Source: ProtInc
  3. protein binding Source: IntAct
  4. Rab GTPase activator activity Source: InterPro
  5. tubulin binding Source: ProtInc

GO - Biological processi

  1. cell cycle Source: ProtInc
  2. positive regulation of GTPase activity Source: GOC
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Keywords - Biological processi

Cell cycle

Names & Taxonomyi

Protein namesi
Recommended name:
Rab GTPase-activating protein 1
Alternative name(s):
GAP and centrosome-associated protein
Rab6 GTPase-activating protein GAPCenA
Gene namesi
Name:RABGAP1
ORF Names:HSPC094
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:17155. RABGAP1.

Subcellular locationi

Cytoplasmcytosol. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome
Note: Predominantly cytosolic but also associated with the centrosome.1 Publication

GO - Cellular componenti

  1. centrosome Source: ProtInc
  2. cytosol Source: ProtInc
  3. microtubule associated complex Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134977298.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10691069Rab GTPase-activating protein 1PRO_0000298779Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei996 – 9961Phosphothreonine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9Y3P9.
PaxDbiQ9Y3P9.
PRIDEiQ9Y3P9.

PTM databases

PhosphoSiteiQ9Y3P9.

Expressioni

Gene expression databases

ArrayExpressiQ9Y3P9.
BgeeiQ9Y3P9.
CleanExiHS_RABGAP1.
GenevestigatoriQ9Y3P9.

Interactioni

Subunit structurei

Interacts with RAB6A and tubulin gamma.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
GABARAPL1Q9H0R82EBI-1057545,EBI-746969

Protein-protein interaction databases

BioGridi117166. 15 interactions.
IntActiQ9Y3P9. 13 interactions.
MINTiMINT-258769.
STRINGi9606.ENSP00000362751.

Structurei

3D structure databases

ProteinModelPortaliQ9Y3P9.
SMRiQ9Y3P9. Positions 538-825.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini142 – 298157PIDAdd
BLAST
Domaini566 – 752187Rab-GAP TBCAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili798 – 1047250 Reviewed predictionAdd
BLAST

Domaini

The arginine and glutamine fingers are critical for the GTPase-activating mechanism, they pull out Rab's 'switch 2' glutamine and insert in Rab's active site By similarity.

Sequence similaritiesi

Contains 1 PID domain.
Contains 1 Rab-GAP TBC domain.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiCOG5210.
HOGENOMiHOG000007923.
HOVERGENiHBG063892.
InParanoidiQ9Y3P9.
OMAiMIPSPPE.
OrthoDBiEOG751NDS.
PhylomeDBiQ9Y3P9.
TreeFamiTF317184.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR009057. Homeodomain-like.
IPR022164. Kinesin-like.
IPR011993. PH_like_dom.
IPR006020. PTB/PI_dom.
IPR000195. Rab-GTPase-TBC_dom.
[Graphical view]
PfamiPF12473. DUF3694. 1 hit.
PF00640. PID. 1 hit.
PF00566. RabGAP-TBC. 1 hit.
[Graphical view]
SMARTiSM00462. PTB. 1 hit.
SM00164. TBC. 1 hit.
[Graphical view]
SUPFAMiSSF47923. SSF47923. 2 hits.
PROSITEiPS01179. PID. 1 hit.
PS50086. TBC_RABGAP. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 11 Publication (identifier: Q9Y3P9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDDKASVGKI SVSSDSVSTL NSEDFVLVSR QGDETPSTNN GSDDEKTGLK     50
IVGNGSEQQL QKELADVLMD PPMDDQPGEK ELVKRSQLDG EGDGPLSNQL 100
SASSTINPVP LVGLQKPEMS LPVKPGQGDS EASSPFTPVA DEDSVVFSKL 150
TYLGCASVNA PRSEVEALRM MSILRSQCQI SLDVTLSVPN VSEGIVRLLD 200
PQTNTEIANY PIYKILFCVR GHDGTPESDC FAFTESHYNA ELFRIHVFRC 250
EIQEAVSRIL YSFATAFRRS AKQTPLSATA APQTPDSDIF TFSVSLEIKE 300
DDGKGYFSAV PKDKDRQCFK LRQGIDKKIV IYVQQTTNKE LAIERCFGLL 350
LSPGKDVRNS DMHLLDLESM GKSSDGKSYV ITGSWNPKSP HFQVVNEETP 400
KDKVLFMTTA VDLVITEVQE PVRFLLETKV RVCSPNERLF WPFSKRSTTE 450
NFFLKLKQIK QRERKNNTDT LYEVVCLESE SERERRKTTA SPSVRLPQSG 500
SQSSVIPSPP EDDEEEDNDE PLLSGSGDVS KECAEKILET WGELLSKWHL 550
NLNVRPKQLS SLVRNGVPEA LRGEVWQLLA GCHNNDHLVE KYRILITKES 600
PQDSAITRDI NRTFPAHDYF KDTGGDGQDS LYKICKAYSV YDEEIGYCQG 650
QSFLAAVLLL HMPEEQAFSV LVKIMFDYGL RELFKQNFED LHCKFYQLER 700
LMQEYIPDLY NHFLDISLEA HMYASQWFLT LFTAKFPLYM VFHIIDLLLC 750
EGISVIFNVA LGLLKTSKDD LLLTDFEGAL KFFRVQLPKR YRSEENAKKL 800
MELACNMKIS QKKLKKYEKE YHTMREQQAQ QEDPIERFER ENRRLQEANM 850
RLEQENDDLA HELVTSKIAL RKDLDNAEEK ADALNKELLM TKQKLIDAEE 900
EKRRLEEESA QLKEMCRREL DKAESEIKKN SSIIGDYKQI CSQLSERLEK 950
QQTANKVEIE KIRQKVDDCE RCREFFNKEG RVKGISSTKE VLDEDTDEEK 1000
ETLKNQLREM ELELAQTKLQ LVEAECKIQD LEHHLGLALN EVQAAKKTWF 1050
NRTLSSIKTA TGVQGKETC 1069
Length:1,069
Mass (Da):121,737
Last modified:August 21, 2007 - v3
Checksum:iF3B09BD3CF993F3A
GO
Isoform 21 Publication (identifier: Q9Y3P9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.
     637-667: AYSVYDEEIGYCQGQSFLAAVLLLHMPEEQA → VFHVKKKKDSILSGGSTLKLHKKQLQSVICI
     668-1069: Missing.

Note: No experimental confirmation available.

Show »
Length:599
Mass (Da):67,098
Checksum:i549686265A37B8BB
GO
Isoform 31 Publication (identifier: Q9Y3P9-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     480-1069: Missing.

Note: No experimental confirmation available.

Show »
Length:479
Mass (Da):53,195
Checksum:i56599C32796E7909
GO
Isoform 41 Publication (identifier: Q9Y3P9-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     258-265: RILYSFAT → PQEKTLCK
     266-1069: Missing.

Note: No experimental confirmation available.

Show »
Length:265
Mass (Da):28,712
Checksum:i7BA5E80C1D8A71FF
GO

Sequence cautioni

The sequence AAH20609.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
The sequence AK022408 differs from that shown. Reason: Intron retention.
The sequence AAF28917.1 differs from that shown. Reason: Frameshift at several positions.
The sequence AAH54492.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAB40267.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6868Missing in isoform 2. 1 PublicationVSP_052510Add
BLAST
Alternative sequencei258 – 2658RILYSFAT → PQEKTLCK in isoform 4. 1 PublicationVSP_052511
Alternative sequencei266 – 1069804Missing in isoform 4. 1 PublicationVSP_052512Add
BLAST
Alternative sequencei480 – 1069590Missing in isoform 3. 1 PublicationVSP_052515Add
BLAST
Alternative sequencei637 – 66731AYSVY…PEEQA → VFHVKKKKDSILSGGSTLKL HKKQLQSVICI in isoform 2. 1 PublicationVSP_052513Add
BLAST
Alternative sequencei668 – 1069402Missing in isoform 2. 1 PublicationVSP_052514Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ011679 mRNA. Translation: CAB40267.2. Different initiation.
AB449897 mRNA. Translation: BAH16640.1.
AF161357 mRNA. Translation: AAF28917.1. Frameshift.
AK022408 mRNA. No translation available.
AK131449 mRNA. Translation: BAD18594.1.
AL365338, AC007066 Genomic DNA. Translation: CAH70298.2.
CH471090 Genomic DNA. Translation: EAW87555.1.
BC020609 mRNA. Translation: AAH20609.1. Sequence problems.
BC054492 mRNA. Translation: AAH54492.1. Different initiation.
AL050195 mRNA. Translation: CAB43313.1.
CCDSiCCDS6848.2. [Q9Y3P9-1]
PIRiT13163.
RefSeqiNP_036329.3. NM_012197.3. [Q9Y3P9-1]
XP_005251923.1. XM_005251866.1. [Q9Y3P9-1]
XP_006717094.1. XM_006717031.1. [Q9Y3P9-1]
UniGeneiHs.271341.

Genome annotation databases

EnsembliENST00000373647; ENSP00000362751; ENSG00000011454. [Q9Y3P9-1]
ENST00000456584; ENSP00000414386; ENSG00000011454. [Q9Y3P9-2]
GeneIDi23637.
KEGGihsa:23637.
UCSCiuc004bnm.1. human. [Q9Y3P9-4]
uc011lzh.2. human. [Q9Y3P9-1]

Polymorphism databases

DMDMi156633605.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ011679 mRNA. Translation: CAB40267.2 . Different initiation.
AB449897 mRNA. Translation: BAH16640.1 .
AF161357 mRNA. Translation: AAF28917.1 . Frameshift.
AK022408 mRNA. No translation available.
AK131449 mRNA. Translation: BAD18594.1 .
AL365338 , AC007066 Genomic DNA. Translation: CAH70298.2 .
CH471090 Genomic DNA. Translation: EAW87555.1 .
BC020609 mRNA. Translation: AAH20609.1 . Sequence problems.
BC054492 mRNA. Translation: AAH54492.1 . Different initiation.
AL050195 mRNA. Translation: CAB43313.1 .
CCDSi CCDS6848.2. [Q9Y3P9-1 ]
PIRi T13163.
RefSeqi NP_036329.3. NM_012197.3. [Q9Y3P9-1 ]
XP_005251923.1. XM_005251866.1. [Q9Y3P9-1 ]
XP_006717094.1. XM_006717031.1. [Q9Y3P9-1 ]
UniGenei Hs.271341.

3D structure databases

ProteinModelPortali Q9Y3P9.
SMRi Q9Y3P9. Positions 538-825.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117166. 15 interactions.
IntActi Q9Y3P9. 13 interactions.
MINTi MINT-258769.
STRINGi 9606.ENSP00000362751.

PTM databases

PhosphoSitei Q9Y3P9.

Polymorphism databases

DMDMi 156633605.

Proteomic databases

MaxQBi Q9Y3P9.
PaxDbi Q9Y3P9.
PRIDEi Q9Y3P9.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000373647 ; ENSP00000362751 ; ENSG00000011454 . [Q9Y3P9-1 ]
ENST00000456584 ; ENSP00000414386 ; ENSG00000011454 . [Q9Y3P9-2 ]
GeneIDi 23637.
KEGGi hsa:23637.
UCSCi uc004bnm.1. human. [Q9Y3P9-4 ]
uc011lzh.2. human. [Q9Y3P9-1 ]

Organism-specific databases

CTDi 23637.
GeneCardsi GC09P125703.
H-InvDB HIX0008361.
HGNCi HGNC:17155. RABGAP1.
neXtProti NX_Q9Y3P9.
PharmGKBi PA134977298.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5210.
HOGENOMi HOG000007923.
HOVERGENi HBG063892.
InParanoidi Q9Y3P9.
OMAi MIPSPPE.
OrthoDBi EOG751NDS.
PhylomeDBi Q9Y3P9.
TreeFami TF317184.

Miscellaneous databases

ChiTaRSi RABGAP1. human.
GeneWikii RABGAP1.
GenomeRNAii 23637.
NextBioi 46429.
PROi Q9Y3P9.

Gene expression databases

ArrayExpressi Q9Y3P9.
Bgeei Q9Y3P9.
CleanExi HS_RABGAP1.
Genevestigatori Q9Y3P9.

Family and domain databases

Gene3Di 1.10.10.60. 1 hit.
2.30.29.30. 1 hit.
InterProi IPR009057. Homeodomain-like.
IPR022164. Kinesin-like.
IPR011993. PH_like_dom.
IPR006020. PTB/PI_dom.
IPR000195. Rab-GTPase-TBC_dom.
[Graphical view ]
Pfami PF12473. DUF3694. 1 hit.
PF00640. PID. 1 hit.
PF00566. RabGAP-TBC. 1 hit.
[Graphical view ]
SMARTi SM00462. PTB. 1 hit.
SM00164. TBC. 1 hit.
[Graphical view ]
SUPFAMi SSF47923. SSF47923. 2 hits.
PROSITEi PS01179. PID. 1 hit.
PS50086. TBC_RABGAP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of GAPCenA, a GTPase activating protein for Rab6, part of which associates with the centrosome."
    Cuif M.-H., Possmayer F., Zander H., Bordes N., Jollivet F., Couedel-Courteille A., Janoueix-Lerosey I., Langsley G., Bornens M., Goud B.
    EMBO J. 18:1772-1782(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH RAB6A AND TUBULIN GAMMA, SUBCELLULAR LOCATION.
    Tissue: Placenta.
  2. "Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity."
    Ishibashi K., Kanno E., Itoh T., Fukuda M.
    Genes Cells 14:41-52(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Tissue: Brain.
  3. "Human partial CDS from CD34+ stem cells."
    Zhang Q.H., Ye M., Zhou J., Shen Y., Wu X.Y., Guan Z.Q., Wang L., Fan H.Y., Mao Y.F., Dai M., Huang Q.H., Chen S.J., Chen Z.
    Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Umbilical cord blood.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
    Tissue: Mammary gland and Testis.
  5. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta and Uterus.
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 824-1069 (ISOFORM 1).
    Tissue: Uterus.
  9. "A role for the Rab6A' GTPase in the inactivation of the Mad2-spindle checkpoint."
    Miserey-Lenkei S., Couedel-Courteille A., Del Nery E., Bardin S., Piel M., Racine V., Sibarita J.-B., Perez F., Bornens M., Goud B.
    EMBO J. 25:278-289(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-996, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiRBGP1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y3P9
Secondary accession number(s): B9A6L2
, Q05CW2, Q6ZMY1, Q9HA28, Q9P0E2, Q9UG67
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: August 21, 2007
Last modified: July 9, 2014
This is version 116 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi