Q9Y3P9 (RBGP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Rab GTPase-activating protein 1 Alternative name(s): GAP and centrosome-associated protein Rab6 GTPase-activating protein GAPCenA | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1069 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May act as a GTPase-activating protein of RAB6A. May play a role in microtubule nucleation by centrosome. May participate in a RAB6A-mediated pathway involved in the metaphase-anaphase transition. Ref.1 Ref.9 |
| Subunit structure | Interacts with RAB6A and tubulin gamma. Ref.1 |
| Subcellular location | Cytoplasm › cytosol. Cytoplasm › cytoskeleton › centrosome. Note: Predominantly cytosolic but also associated with the centrosome. Ref.1 |
| Sequence similarities | Contains 1 PID domain. Contains 1 Rab-GAP TBC domain. |
| Sequence caution | The sequence AAF28917.1 differs from that shown. Reason: Frameshift at several positions. The sequence AAH20609.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. The sequence AAH54492.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AK022408 differs from that shown. Reason: Intron retention. The sequence CAB40267.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell cycle |
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Molecular function | GTPase activation |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell cycle Traceable author statement Ref.1. Source: ProtInc positive regulation of Rab GTPase activityInferred from electronic annotation. Source: GOC |
| Cellular_component | centrosome Traceable author statement Ref.1. Source: ProtInc cytosolTraceable author statement Ref.1. Source: ProtInc microtubule associated complexTraceable author statement Ref.1. Source: ProtInc |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: InterPro GTPase activator activityTraceable author statement Ref.1. Source: ProtInc Rab GTPase activator activityInferred from electronic annotation. Source: InterPro tubulin bindingTraceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| GABARAPL1 | Q9H0R8 | 2 | EBI-1057545,EBI-746969 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 (identifier: Q9Y3P9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.4 (identifier: Q9Y3P9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-68: Missing. 637-667: AYSVYDEEIGYCQGQSFLAAVLLLHMPEEQA → VFHVKKKKDSILSGGSTLKLHKKQLQSVICI 668-1069: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 Ref.2 (identifier: Q9Y3P9-3) The sequence of this isoform differs from the canonical sequence as follows: 480-1069: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 Ref.4 (identifier: Q9Y3P9-4) The sequence of this isoform differs from the canonical sequence as follows: 258-265: RILYSFAT → PQEKTLCK 266-1069: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1069 | 1069 | Rab GTPase-activating protein 1 | PRO_0000298779 | |||||
Regions | |||||||||
| Domain | 142 – 298 | 157 | PID | ||||||
| Domain | 566 – 752 | 187 | Rab-GAP TBC | ||||||
| Coiled coil | 798 – 1047 | 250 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 996 | 1 | Phosphothreonine Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 68 | 68 | Missing in isoform 2. Ref.4 | VSP_052510 | |||||
| Alternative sequence | 258 – 265 | 8 | RILYSFAT → PQEKTLCK in isoform 4. Ref.4 | VSP_052511 | |||||
| Alternative sequence | 266 – 1069 | 804 | Missing in isoform 4. Ref.4 | VSP_052512 | |||||
| Alternative sequence | 480 – 1069 | 590 | Missing in isoform 3. Ref.2 | VSP_052515 | |||||
| Alternative sequence | 637 – 667 | 31 | AYSVY…PEEQA → VFHVKKKKDSILSGGSTLKL HKKQLQSVICI in isoform 2. Ref.4 | VSP_052513 | |||||
| Alternative sequence | 668 – 1069 | 402 | Missing in isoform 2. Ref.4 | VSP_052514 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of GAPCenA, a GTPase activating protein for Rab6, part of which associates with the centrosome." Cuif M.-H., Possmayer F., Zander H., Bordes N., Jollivet F., Couedel-Courteille A., Janoueix-Lerosey I., Langsley G., Bornens M., Goud B. EMBO J. 18:1772-1782(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH RAB6A AND TUBULIN GAMMA, SUBCELLULAR LOCATION. Tissue: Placenta. |
| [2] | "Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity." Ishibashi K., Kanno E., Itoh T., Fukuda M. Genes Cells 14:41-52(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Brain. |
| [3] | "Human partial CDS from CD34+ stem cells." Zhang Q.H., Ye M., Zhou J., Shen Y., Wu X.Y., Guan Z.Q., Wang L., Fan H.Y., Mao Y.F., Dai M., Huang Q.H., Chen S.J., Chen Z. Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Umbilical cord blood. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4). Tissue: Mammary gland and Testis. |
| [5] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta and Uterus. |
| [8] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 824-1069 (ISOFORM 1). Tissue: Uterus. |
| [9] | "A role for the Rab6A' GTPase in the inactivation of the Mad2-spindle checkpoint." Miserey-Lenkei S., Couedel-Courteille A., Del Nery E., Bardin S., Piel M., Racine V., Sibarita J.-B., Perez F., Bornens M., Goud B. EMBO J. 25:278-289(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-996, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ011679 mRNA. Translation: CAB40267.2. Different initiation. AB449897 mRNA. Translation: BAH16640.1. AF161357 mRNA. Translation: AAF28917.1. Frameshift. AK022408 mRNA. No translation available. AK131449 mRNA. Translation: BAD18594.1. AL365338, AC007066 Genomic DNA. Translation: CAH70298.2. CH471090 Genomic DNA. Translation: EAW87555.1. BC020609 mRNA. Translation: AAH20609.1. Sequence problems. BC054492 mRNA. Translation: AAH54492.1. Different initiation. AL050195 mRNA. Translation: CAB43313.1. |
| IPI | IPI00016702. IPI00386898. IPI00855799. IPI00856033. |
| PIR | T13163. |
| RefSeq | NP_036329.3. NM_012197.3. |
| UniGene | Hs.271341. |
3D structure databases | |
| ProteinModelPortal | Q9Y3P9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9Y3P9. 12 interactions. |
| MINT | MINT-258769. |
| STRING | 9606.ENSP00000362751. |
PTM databases | |
| PhosphoSite | Q9Y3P9. |
Polymorphism databases | |
| DMDM | 156633605. |
Proteomic databases | |
| PaxDb | Q9Y3P9. |
| PRIDE | Q9Y3P9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000317419; ENSP00000324973; ENSG00000011454. ENST00000373647; ENSP00000362751; ENSG00000011454. ENST00000456584; ENSP00000414386; ENSG00000011454. |
| GeneID | 23637. |
| KEGG | hsa:23637. |
| UCSC | uc004bnm.1. human. uc011lzh.2. human. |
Organism-specific databases | |
| CTD | 23637. |
| GeneCards | GC09P125703. |
| H-InvDB | HIX0008361. |
| HGNC | HGNC:17155. RABGAP1. |
| neXtProt | NX_Q9Y3P9. |
| PharmGKB | PA134977298. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5210. |
| HOGENOM | HOG000007923. |
| HOVERGEN | HBG063892. |
| InParanoid | Q9Y3P9. |
| OMA | MIPSPPE. |
| OrthoDB | EOG4QC14X. |
Gene expression databases | |
| ArrayExpress | Q9Y3P9. |
| Bgee | Q9Y3P9. |
| CleanEx | HS_RABGAP1. |
| Genevestigator | Q9Y3P9. |
Family and domain databases | |
| Gene3D | 1.10.10.60. 1 hit. 2.30.29.30. 1 hit. |
| InterPro | IPR009057. Homeodomain-like. IPR022164. Kinesin-like. IPR011993. PH_like_dom. IPR006020. PTyr_interaction_dom. IPR000195. Rab-GTPase-TBC_dom. [Graphical view] |
| Pfam | PF12473. DUF3694. 1 hit. PF00640. PID. 1 hit. PF00566. RabGAP-TBC. 1 hit. [Graphical view] |
| SMART | SM00462. PTB. 1 hit. SM00164. TBC. 1 hit. [Graphical view] |
| SUPFAM | SSF47923. RabGAP_TBC. 2 hits. |
| PROSITE | PS01179. PID. 1 hit. PS50086. TBC_RABGAP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | RABGAP1. human. |
| GenomeRNAi | 23637. |
| NextBio | 46429. |
Entry information
| Entry name | RBGP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y3P9 Secondary accession number(s): B9A6L2 Q9UG67 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
