Q9Y3E7 (CHMP3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Charged multivesicular body protein 3 Alternative name(s): Chromatin-modifying protein 3 Neuroendocrine differentiation factor Vacuolar protein sorting-associated protein 24 Short name=hVps24 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 222 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Selectively binds to phosphatidylinositol 3,5-bisphosphate PtdIns(3,5)P2 and PtdIns(3,4)P2 in preference to other phosphoinositides tested. Involved in late stages of cytokinesis. Plays a role in endosomal sorting/trafficking of EGF receptor. Isoform 2 prevents stress-mediated cell death and accumulation of reactive oxygen species when expressed in yeast cells. Ref.2 Ref.4 Ref.10 Ref.22 Ref.26 |
| Subunit structure | Probable core component of the endosomal sorting required for transport complex III (ESCRT-III). ESCRT-III components are thought to multimerize to form a flat lattice on the perimeter membrane of the endosome. Several assembly forms of ESCRT-III may exist that interact and act sequentally. Forms a metastable monomer in solution; its core structure (without part of the putative autoinhibitory C-terminal acidic region) oligomerizes into a flat lattice via two different dimerization interfaces. In vitro, heteromerizes with CHMP2A (but not CHMP4) to form helical tubular structures that expose membrane-interacting sites on the outside whereas VPS4B can associate on the inside of the tubule. May interact with IGFBP7; the relevance of such interaction however remains unclear. Interacts with CHMP2A. Interacts with CHMP4A; the interaction requires the release of CHMP4A autoinhibition. Interacts with VPS4A. Interacts with STAMBP; the interaction appears to relieve the autoinhibition of CHMP3. Ref.1 Ref.10 Ref.11 Ref.15 Ref.16 Ref.17 Ref.18 Ref.21 Ref.23 Ref.26 Ref.27 |
| Subcellular location | Cytoplasm › cytosol. Membrane; Lipid-anchor. Endosome. Late endosome membrane Probable. Note: Localizes to the midbody of dividing cells. Ref.2 Ref.15 Ref.22 |
| Tissue specificity | Widely expressed. Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Ref.13 |
| Domain | The acidic C-terminus and the basic N-termminus are thought to render the protein in a closed, soluble and inactive conformation through an autoinhibitory intramolecular interaction. The open and active conformation, which enables membrane binding and oligomerization, is achieved by interaction with other cellular binding partners, probably including other ESCRT components. |
| Miscellaneous | Its overexpression strongly inhibits HIV-1 release. |
| Sequence similarities | Belongs to the SNF7 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis Cell cycle Cell division Protein transport Transport |
| Cellular component | Cytoplasm Endosome Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| PTM | Isopeptide bond Lipoprotein Myristate Phosphoprotein Ubl conjugation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell cycle Inferred from electronic annotation. Source: UniProtKB-KW cellular membrane organizationTraceable author statement. Source: Reactome protein transportInferred from electronic annotation. Source: InterPro |
| Cellular component | cytosol Traceable author statement. Source: Reactome late endosome membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| STAMBP | O95630 | 5 | EBI-2118119,EBI-396676 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y3E7-1) Also known as: Vps24alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y3E7-2) Also known as: Vps24beta; The sequence of this isoform differs from the canonical sequence as follows: 1-66: Missing. | ||||||
| Isoform 3 (identifier: Q9Y3E7-3) The sequence of this isoform differs from the canonical sequence as follows: 1-15: MGLFGKTQEKPPKEL → MEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWLVQ | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9Y3E7-4) The sequence of this isoform differs from the canonical sequence as follows: 74-113: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||
Molecule processing | ||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Potential | |||||||||||||||||||
| Chain | 2 – 222 | 221 | Charged multivesicular body protein 3 | PRO_0000211479 | ||||||||||||||||||
Regions | ||||||||||||||||||||||
| Region | 2 – 113 | 112 | Intramolecular interaction with C-terminus | |||||||||||||||||||
| Region | 59 – 64 | 6 | Important for autoinhibitory function | |||||||||||||||||||
| Region | 151 – 222 | 72 | Interaction with VPS4A | |||||||||||||||||||
| Region | 151 – 220 | 70 | Intramolecular interaction with N-terminus | |||||||||||||||||||
| Region | 168 – 169 | 2 | Important for autoinhibitory function | |||||||||||||||||||
| Region | 203 – 207 | 5 | Interaction with STAMBP | |||||||||||||||||||
| Region | 221 – 222 | 2 | Interaction with STAMBP | |||||||||||||||||||
| Coiled coil | 22 – 54 | 33 | Potential | |||||||||||||||||||
| Coiled coil | 141 – 222 | 82 | Potential | |||||||||||||||||||
| Motif | 201 – 211 | 11 | MIT-interacting motif | |||||||||||||||||||
Sites | ||||||||||||||||||||||
| Binding site | 216 | 1 | STAMBP | |||||||||||||||||||
| Site | 48 | 1 | Important for autoinhibitory function | |||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||
| Modified residue | 116 | 1 | Phosphoserine By similarity | |||||||||||||||||||
| Modified residue | 126 | 1 | Phosphothreonine By similarity | |||||||||||||||||||
| Modified residue | 200 | 1 | Phosphoserine Ref.14 Ref.20 Ref.24 | |||||||||||||||||||
| Lipidation | 2 | 1 | N-myristoyl glycine Potential | |||||||||||||||||||
| Cross-link | 179 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.19 | ||||||||||||||||||||
Natural variations | ||||||||||||||||||||||
| Alternative sequence | 1 – 66 | 66 | Missing in isoform 2. | VSP_041076 | ||||||||||||||||||
| Alternative sequence | 1 – 15 | 15 | MGLFG…PPKEL → MEGELYSALKEEEASESVSS TNFSGEMHFYELVEDTKDGI WLVQ in isoform 3. | VSP_042124 | ||||||||||||||||||
| Alternative sequence | 74 – 113 | 40 | Missing in isoform 4. | VSP_042125 | ||||||||||||||||||
Experimental info | ||||||||||||||||||||||
| Mutagenesis | 24 – 25 | 2 | RK → SA: Impairs HIV-1 release; when associated with S-28. | |||||||||||||||||||
| Mutagenesis | 28 | 1 | R → S: Impairs HIV-1 release; when associated with 24-S-A-25. Ref.26 | |||||||||||||||||||
| Mutagenesis | 48 | 1 | V → D: Induces assembly with CHMP2A into helical tubes in vitro; when associated with D-64. Enhances inhibition of HIV-1 budding in vivo; when associated with D-168 and D-169. Ref.27 | |||||||||||||||||||
| Mutagenesis | 54 | 1 | K → S: Abolishes dimerization; when associated with N-56; E-59 and 62-D-E-63. Ref.26 | |||||||||||||||||||
| Mutagenesis | 56 | 1 | Q → N: Abolishes dimerization; when associated with S-54; E-59 and 62-D-E-63. Ref.26 | |||||||||||||||||||
| Mutagenesis | 59 | 1 | V → D: Abolishes interaction with CHMP2A and assembly into helical tubes in vitro; when associated with D-62; D-168 and D-169. Ref.26 Ref.27 | |||||||||||||||||||
| Mutagenesis | 59 | 1 | V → E: Abolishes dimerization; when associated with S-54; N-56 and 62-D-E-63. Ref.26 Ref.27 | |||||||||||||||||||
| Mutagenesis | 62 – 63 | 2 | VL → DE: Abolishes dimerization; when associated with S-54; N-56 and E-59. Ref.27 | |||||||||||||||||||
| Mutagenesis | 62 | 1 | V → D: Abolishes interaction with CHMP2A and assembly into helical tubes in vitro; when associated with D-59; D-168 and D-169. Ref.27 | |||||||||||||||||||
| Mutagenesis | 64 | 1 | A → D: Induces assembly with CHMP2A into helical tubes in vitro; when associated with D-48. Ref.27 | |||||||||||||||||||
| Mutagenesis | 78 – 79 | 2 | YA → AE: Abolishes dimerization. | |||||||||||||||||||
| Mutagenesis | 168 – 169 | 2 | IL → DD: Induces assembly with CHMP2A into helical tubes in vitro and slightly enhances inhibition of HIV-1 budding in vivo. Abolishes interaction with CHMP2A and assembly into helical tubes in vitro; when associated with D-59 and D-62. | |||||||||||||||||||
| Mutagenesis | 179 – 222 | 44 | Missing: Membrane association; releases autoinhibition. Ref.16 Ref.18 | |||||||||||||||||||
| Mutagenesis | 216 – 217 | 2 | RL → AA: Abolishes interaction with VPS4A and STAMBP. | |||||||||||||||||||
| Mutagenesis | 221 – 222 | 2 | Missing: Abolishes interaction with VPS4A and STAMBP. Ref.16 | |||||||||||||||||||
| Mutagenesis | 222 | 1 | Missing: Impairs interaction with VPS4A and STAMBP. Ref.16 | |||||||||||||||||||
| Sequence conflict | 208 | 1 | E → D in AAF26737. Ref.1 | |||||||||||||||||||
Secondary structure | ||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||
| Helix | 15 – 53 | 39 | ||||||||||||||||||||
| Helix | 57 – 100 | 44 | ||||||||||||||||||||
| Helix | 109 – 112 | 4 | ||||||||||||||||||||
| Turn | 113 – 115 | 3 | ||||||||||||||||||||
| Beta strand | 120 – 122 | 3 | ||||||||||||||||||||
| Helix | 125 – 137 | 13 | ||||||||||||||||||||
| Helix | 164 – 167 | 4 | ||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Interaction of IGF-binding protein-related protein 1 with a novel protein, neuroendocrine differentiation factor, results in neuroendocrine differentiation of prostate cancer cells." Wilson E.M., Oh Y., Hwa V., Rosenfeld R.G. J. Clin. Endocrinol. Metab. 86:4504-4511(2001) [PubMed: 11549700] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), POSSIBLE INTERACTION WITH IGFBP7. |
| [2] | "mVps24p functions in EGF receptor sorting/trafficking from the early endosome." Yan Q., Hunt P.R., Frelin L., Vida T.A., Pevsner J., Bean A.J. Exp. Cell Res. 304:265-273(2005) [PubMed: 15707591] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION. Tissue: Heart. |
| [3] | "NovelFam3000 -- uncharacterized human protein domains conserved across model organisms." Kemmer D., Podowski R.M., Arenillas D., Lim J., Hodges E., Roth P., Sonnhammer E.L.L., Hoeoeg C., Wasserman W.W. BMC Genomics 7:48-48(2006) [PubMed: 16533400] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Characterization of a novel alternatively spliced human transcript encoding an N-terminally truncated Vps24 protein that suppresses the effects of Bax in an ESCRT independent manner in yeast." Khoury C.M., Yang Z., Ismail S., Greenwood M.T. Gene 391:233-241(2007) [PubMed: 17331679] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION. Tissue: Heart. |
| [5] | "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics." Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C. Genome Res. 10:703-713(2000) [PubMed: 10810093] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Amygdala, Pericardium and Synovial cell. |
| [7] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Uterus. |
| [10] | "The protein network of HIV budding." von Schwedler U.K., Stuchell M., Mueller B., Ward D.M., Chung H.-Y., Morita E., Wang H.E., Davis T., He G.P., Cimbora D.M., Scott A., Kraeusslich H.-G., Kaplan J., Morham S.G., Sundquist W.I. Cell 114:701-713(2003) [PubMed: 14505570] [Abstract] Cited for: FUNCTION IN HIV-1 BUDDING, INTERACTION WITH CHMP4A. |
| [11] | "Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins." Martin-Serrano J., Yarovoy A., Perez-Caballero D., Bieniasz P.D. Proc. Natl. Acad. Sci. U.S.A. 100:12414-12419(2003) [PubMed: 14519844] [Abstract] Cited for: INTERACTION WITH CHMP2A AND VPS4A. |
| [12] | Erratum Martin-Serrano J., Yarovoy A., Perez-Caballero D., Bieniasz P.D. Proc. Natl. Acad. Sci. U.S.A. 100:152845-152845(2003) |
| [13] | "Interaction of the mammalian endosomal sorting complex required for transport (ESCRT) III protein hSnf7-1 with itself, membranes, and the AAA+ ATPase SKD1." Lin Y., Kimpler L.A., Naismith T.V., Lauer J.M., Hanson P.I. J. Biol. Chem. 280:12799-12809(2005) [PubMed: 15632132] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [14] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-200, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex." Tsang H.T.H., Connell J.W., Brown S.E., Thompson A., Reid E., Sanderson C.M. Genomics 88:333-346(2006) [PubMed: 16730941] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH STAMBP. |
| [16] | "Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding." Zamborlini A., Usami Y., Radoshitzky S.R., Popova E., Palu G., Goettlinger H. Proc. Natl. Acad. Sci. U.S.A. 103:19140-19145(2006) [PubMed: 17146056] [Abstract] Cited for: AUTOINHIBITORY MECHANISM, INTRAMOLECULAR INTERACTION, INTERACTION WITH STAMBP AND VPS4A, MUTAGENESIS OF 216-ARG-LEU-217; 221-ARG-SER-222 AND SER-222. |
| [17] | "Targeting of AMSH to endosomes is required for epidermal growth factor receptor degradation." Ma Y.M., Boucrot E., Villen J., Affar el B., Gygi S.P., Goettlinger H.G., Kirchhausen T. J. Biol. Chem. 282:9805-9812(2007) [PubMed: 17261583] [Abstract] Cited for: INTERACTION WITH STAMBP, MASS SPECTROMETRY. |
| [18] | "Structure/function analysis of four core ESCRT-III proteins reveals common regulatory role for extreme C-terminal domain." Shim S., Kimpler L.A., Hanson P.I. Traffic 8:1068-1079(2007) [PubMed: 17547705] [Abstract] Cited for: AUTOINHIBITORY MECHANISM, INTERACTION WITH CHMP4A, MUTAGENESIS OF 179-LYS--SER-222. |
| [19] | "Quantitative analysis of global ubiquitination in HeLa cells by mass spectrometry." Meierhofer D., Wang X., Huang L., Kaiser P. J. Proteome Res. 7:4566-4576(2008) [PubMed: 18781797] [Abstract] Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-179, MASS SPECTROMETRY. |
| [20] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-200, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [21] | "Helical structures of ESCRT-III are disassembled by VPS4." Lata S., Schoehn G., Jain A., Pires R., Piehler J., Goettlinger H.G., Weissenhorn W. Science 321:1354-1357(2008) [PubMed: 18687924] [Abstract] Cited for: POLYMERIZATION WITH CHMP2A, ELECTRON MICROSCOPY. |
| [22] | "A dominant-negative ESCRT-III protein perturbs cytokinesis and trafficking to lysosomes." Dukes J.D., Richardson J.D., Simmons R., Whitley P. Biochem. J. 411:233-239(2008) [PubMed: 18076377] [Abstract] Cited for: FUNCTION IN CYTOKINESIS, SUBCELLULAR LOCATION. |
| [23] | "Structural basis for autoinhibition of ESCRT-III CHMP3." Lata S., Roessle M., Solomons J., Jamin M., Goettlinger H.G., Svergun D.I., Weissenhorn W. J. Mol. Biol. 378:818-827(2008) [PubMed: 18395747] [Abstract] Cited for: AUTOINHIBITORY MECHANISM, INTERACTION WITH STAMBP. |
| [24] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-200, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [25] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [26] | "Structural basis for budding by the ESCRT-III factor CHMP3." Muziol T., Pineda-Molina E., Ravelli R.B., Zamborlini A., Usami Y., Goettlinger H., Weissenhorn W. Dev. Cell 10:821-830(2006) [PubMed: 16740483] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 5-183, SUBUNIT, FUNCTION IN HIV-1 BUDDING, MUTAGENESIS OF 24-ARG-LYS-25; ARG-28; LYS-54; GLN-56; VAL-59; 62-VAL-LEU-63 AND 78-TYR-ALA-79. |
| [27] | "Structural basis for ESCRT-III protein autoinhibition." Bajorek M., Schubert H.L., McCullough J., Langelier C., Eckert D.M., Stubblefield W.M., Uter N.T., Myszka D.G., Hill C.P., Sundquist W.I. Nat. Struct. Mol. Biol. 16:754-762(2009) [PubMed: 19525971] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.70 ANGSTROMS) OF 1-222, INTERACTION WITH CHMP2A, MUTAGENESIS OF VAL-48; VAL-59; VAL-62; ALA-64 AND 168-ILE-LEU-169. |
| [28] | "Structural basis for Escrt-III Chmp3 recruitment of Amsh." Solomons J., Sabin C., Poudevigne E., Usami Y., Hulsik D.L., Macheboeuf P., Hartlieb B., Gottlinger H., Weissenhorn W. Structure 19:1149-1159(2011) [PubMed: 21827950] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 183-222 IN COMPLEX WITH STAMBP FRAGMENT. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF219226 mRNA. Translation: AAF26737.1. AY364249 mRNA. Translation: AAQ76808.1. AF151907 mRNA. Translation: AAD34144.1. AK290725 mRNA. Translation: BAF83414.1. AK294389 mRNA. Translation: BAG57645.1. AK312353 mRNA. Translation: BAG35273.1. AK315835 mRNA. Translation: BAF98726.1. AC015971 Genomic DNA. Translation: AAX93078.1. AC064848 Genomic DNA. No translation available. AC068288 Genomic DNA. Translation: AAY24211.1. CH471053 Genomic DNA. Translation: EAW99448.1. CH471053 Genomic DNA. Translation: EAW99449.1. CH471053 Genomic DNA. Translation: EAW99450.1. CH471053 Genomic DNA. Translation: EAW99451.1. BC004419 mRNA. Translation: AAH04419.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00100673. IPI00478935. IPI00979305. IPI00981241. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001005753.1. NM_001005753.2. NP_001180446.1. NM_001193517.1. NP_001185883.1. NM_001198954.1. NP_057163.1. NM_016079.3. | ||||||||||||||||||||||||||||||
| UniGene | Hs.591582. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9Y3E7. | ||||||||||||||||||||||||||||||
| SMR | Q9Y3E7. Positions 5-181. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| DIP | DIP-48532N. | ||||||||||||||||||||||||||||||
| IntAct | Q9Y3E7. 5 interactions. | ||||||||||||||||||||||||||||||
| MINT | MINT-1185988. | ||||||||||||||||||||||||||||||
| STRING | Q9Y3E7. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | Q9Y3E7. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 73917763. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PRIDE | Q9Y3E7. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000263856; ENSP00000263856; ENSG00000115561. ENST00000409225; ENSP00000386590; ENSG00000115561. ENST00000409727; ENSP00000387045; ENSG00000115561. ENST00000439940; ENSP00000405575; ENSG00000115561. ENST00000450459; ENSP00000395612; ENSG00000115561. | ||||||||||||||||||||||||||||||
| GeneID | 100526767. 51652. | ||||||||||||||||||||||||||||||
| KEGG | hsa:100526767. hsa:51652. | ||||||||||||||||||||||||||||||
| UCSC | uc002srj.1. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 100526767. 51652. | ||||||||||||||||||||||||||||||
| GeneCards | GC02M086642. | ||||||||||||||||||||||||||||||
| H-InvDB | HIX0002239. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:29865. CHMP3. | ||||||||||||||||||||||||||||||
| HPA | HPA015673. | ||||||||||||||||||||||||||||||
| MIM | 610052. gene. | ||||||||||||||||||||||||||||||
| neXtProt | NX_Q9Y3E7. | ||||||||||||||||||||||||||||||
| PharmGKB | PA134920495. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| GeneTree | ENSGT00550000074896. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG107031. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG4VT5ZB. | ||||||||||||||||||||||||||||||
| PhylomeDB | Q9Y3E7. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| Reactome | REACT_11123. Membrane Trafficking. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | Q9Y3E7. | ||||||||||||||||||||||||||||||
| Bgee | Q9Y3E7. | ||||||||||||||||||||||||||||||
| CleanEx | HS_VPS24. | ||||||||||||||||||||||||||||||
| Genevestigator | Q9Y3E7. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000115561. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR005024. Snf7. [Graphical view] | ||||||||||||||||||||||||||||||
| KO | K12193. | ||||||||||||||||||||||||||||||
| Pfam | PF03357. Snf7. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| NextBio | 55614. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | CHMP3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y3E7 Secondary accession number(s): A8K3W0 Q9NZ51 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with