Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

EKC/KEOPS complex subunit TPRKB

Gene

TPRKB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. TPRKB acts as an allosteric effector that regulates the t6A activity of the complex. TPRKB is not required for tRNA modification (By similarity).By similarity

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

tRNA processing

Enzyme and pathway databases

ReactomeiR-HSA-6782315. tRNA modification in the nucleus and cytosol.

Names & Taxonomyi

Protein namesi
Recommended name:
EKC/KEOPS complex subunit TPRKB
Alternative name(s):
PRPK-binding protein
TP53RK-binding protein
Gene namesi
Name:TPRKB
ORF Names:CGI-121, My019
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:24259. TPRKB.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HPA
  • cytosol Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA143485660.

Polymorphism and mutation databases

BioMutaiTPRKB.
DMDMi74735252.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 175175EKC/KEOPS complex subunit TPRKBPRO_0000279220Add
BLAST

Proteomic databases

EPDiQ9Y3C4.
MaxQBiQ9Y3C4.
PaxDbiQ9Y3C4.
PeptideAtlasiQ9Y3C4.
PRIDEiQ9Y3C4.

PTM databases

iPTMnetiQ9Y3C4.
PhosphoSiteiQ9Y3C4.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiQ9Y3C4.
CleanExiHS_TPRKB.
GenevisibleiQ9Y3C4. HS.

Organism-specific databases

HPAiHPA035712.

Interactioni

Subunit structurei

Component of the EKC/KEOPS complex composed of at least TP53RK, TPRKB, OSGEP and LAGE3; the whole complex dimerizes. Interacts with TP53RK/PRPK.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
TP53RKQ96S443EBI-750123,EBI-739588
TRIM27P143733EBI-750123,EBI-719493

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi119210. 42 interactions.
IntActiQ9Y3C4. 3 interactions.
MINTiMINT-1451673.
STRINGi9606.ENSP00000272424.

Structurei

Secondary structure

1
175
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi3 – 64Combined sources
Beta strandi14 – 229Combined sources
Helixi26 – 3510Combined sources
Beta strandi40 – 434Combined sources
Helixi45 – 473Combined sources
Helixi51 – 6515Combined sources
Turni66 – 683Combined sources
Beta strandi71 – 744Combined sources
Helixi75 – 839Combined sources
Beta strandi85 – 873Combined sources
Helixi89 – 968Combined sources
Beta strandi103 – 1119Combined sources
Helixi120 – 1234Combined sources
Beta strandi126 – 1316Combined sources
Helixi133 – 1386Combined sources
Helixi142 – 1498Combined sources
Helixi158 – 17114Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3ENPX-ray2.48A/B1-175[»]
ProteinModelPortaliQ9Y3C4.
SMRiQ9Y3C4. Positions 1-172.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9Y3C4.

Family & Domainsi

Sequence similaritiesi

Belongs to the CGI121/TPRKB family.Curated

Phylogenomic databases

eggNOGiKOG4066. Eukaryota.
ENOG4111MCN. LUCA.
GeneTreeiENSGT00390000012942.
HOGENOMiHOG000272647.
HOVERGENiHBG056797.
InParanoidiQ9Y3C4.
KOiK15901.
OMAiLQPDPYD.
OrthoDBiEOG7SV0XG.
PhylomeDBiQ9Y3C4.
TreeFamiTF315098.

Family and domain databases

InterProiIPR013926. CGI121/TPRKB.
[Graphical view]
PANTHERiPTHR15840. PTHR15840. 1 hit.
PfamiPF08617. CGI-121. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y3C4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQLTHQLDLF PECRVTLLLF KDVKNAGDLR RKAMEGTIDG SLINPTVIVD
60 70 80 90 100
PFQILVAANK AVHLYKLGKM KTRTLSTEII FNLSPNNNIS EALKKFGISA
110 120 130 140 150
NDTSILIVYI EEGEKQINQE YLISQVEGHQ VSLKNLPEIM NITEVKKIYK
160 170
LSSQEESIGT LLDAIICRMS TKDVL
Length:175
Mass (Da):19,661
Last modified:November 1, 1999 - v1
Checksum:iFB13C0923148C157
GO
Isoform 2 (identifier: Q9Y3C4-2) [UniParc]FASTAAdd to basket

Also known as: S1

The sequence of this isoform differs from the canonical sequence as follows:
     15-47: Missing.

Show »
Length:142
Mass (Da):16,093
Checksum:i12388A00E0205E07
GO
Isoform 3 (identifier: Q9Y3C4-3) [UniParc]FASTAAdd to basket

Also known as: L1

The sequence of this isoform differs from the canonical sequence as follows:
     47-47: V → VFHSCCPGWSAMARSWLTATSASRVQAIVLPQPPELLGLQ

Show »
Length:214
Mass (Da):23,854
Checksum:i8961692D7DF630C7
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti147 – 1471K → R in AAG43133 (Ref. 2) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei15 – 4733Missing in isoform 2. 1 PublicationVSP_023414Add
BLAST
Alternative sequencei47 – 471V → VFHSCCPGWSAMARSWLTAT SASRVQAIVLPQPPELLGLQ in isoform 3. 1 PublicationVSP_023415

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY157986 mRNA. Translation: AAN76356.1.
AY157987 mRNA. Translation: AAN76357.1.
AF060921 mRNA. Translation: AAG43133.1.
AF151879 mRNA. Translation: AAD34116.1.
CH471053 Genomic DNA. Translation: EAW99720.1.
CH471053 Genomic DNA. Translation: EAW99722.1.
BC029492 mRNA. Translation: AAH29492.1.
CCDSiCCDS1927.1. [Q9Y3C4-1]
RefSeqiNP_057142.1. NM_016058.2. [Q9Y3C4-1]
XP_005264400.1. XM_005264343.2. [Q9Y3C4-3]
XP_005264402.1. XM_005264345.3. [Q9Y3C4-1]
XP_006712089.1. XM_006712026.2. [Q9Y3C4-3]
XP_006712090.1. XM_006712027.2. [Q9Y3C4-3]
XP_011531179.1. XM_011532877.1. [Q9Y3C4-3]
XP_011531180.1. XM_011532878.1. [Q9Y3C4-3]
XP_011531181.1. XM_011532879.1. [Q9Y3C4-2]
XP_011531182.1. XM_011532880.1. [Q9Y3C4-2]
UniGeneiHs.157401.

Genome annotation databases

EnsembliENST00000272424; ENSP00000272424; ENSG00000144034. [Q9Y3C4-1]
ENST00000318190; ENSP00000325398; ENSG00000144034. [Q9Y3C4-3]
ENST00000409716; ENSP00000386936; ENSG00000144034. [Q9Y3C4-3]
GeneIDi51002.
KEGGihsa:51002.
UCSCiuc002sjn.3. human. [Q9Y3C4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY157986 mRNA. Translation: AAN76356.1.
AY157987 mRNA. Translation: AAN76357.1.
AF060921 mRNA. Translation: AAG43133.1.
AF151879 mRNA. Translation: AAD34116.1.
CH471053 Genomic DNA. Translation: EAW99720.1.
CH471053 Genomic DNA. Translation: EAW99722.1.
BC029492 mRNA. Translation: AAH29492.1.
CCDSiCCDS1927.1. [Q9Y3C4-1]
RefSeqiNP_057142.1. NM_016058.2. [Q9Y3C4-1]
XP_005264400.1. XM_005264343.2. [Q9Y3C4-3]
XP_005264402.1. XM_005264345.3. [Q9Y3C4-1]
XP_006712089.1. XM_006712026.2. [Q9Y3C4-3]
XP_006712090.1. XM_006712027.2. [Q9Y3C4-3]
XP_011531179.1. XM_011532877.1. [Q9Y3C4-3]
XP_011531180.1. XM_011532878.1. [Q9Y3C4-3]
XP_011531181.1. XM_011532879.1. [Q9Y3C4-2]
XP_011531182.1. XM_011532880.1. [Q9Y3C4-2]
UniGeneiHs.157401.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3ENPX-ray2.48A/B1-175[»]
ProteinModelPortaliQ9Y3C4.
SMRiQ9Y3C4. Positions 1-172.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119210. 42 interactions.
IntActiQ9Y3C4. 3 interactions.
MINTiMINT-1451673.
STRINGi9606.ENSP00000272424.

PTM databases

iPTMnetiQ9Y3C4.
PhosphoSiteiQ9Y3C4.

Polymorphism and mutation databases

BioMutaiTPRKB.
DMDMi74735252.

Proteomic databases

EPDiQ9Y3C4.
MaxQBiQ9Y3C4.
PaxDbiQ9Y3C4.
PeptideAtlasiQ9Y3C4.
PRIDEiQ9Y3C4.

Protocols and materials databases

DNASUi51002.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000272424; ENSP00000272424; ENSG00000144034. [Q9Y3C4-1]
ENST00000318190; ENSP00000325398; ENSG00000144034. [Q9Y3C4-3]
ENST00000409716; ENSP00000386936; ENSG00000144034. [Q9Y3C4-3]
GeneIDi51002.
KEGGihsa:51002.
UCSCiuc002sjn.3. human. [Q9Y3C4-1]

Organism-specific databases

CTDi51002.
GeneCardsiTPRKB.
HGNCiHGNC:24259. TPRKB.
HPAiHPA035712.
MIMi608680. gene.
neXtProtiNX_Q9Y3C4.
PharmGKBiPA143485660.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4066. Eukaryota.
ENOG4111MCN. LUCA.
GeneTreeiENSGT00390000012942.
HOGENOMiHOG000272647.
HOVERGENiHBG056797.
InParanoidiQ9Y3C4.
KOiK15901.
OMAiLQPDPYD.
OrthoDBiEOG7SV0XG.
PhylomeDBiQ9Y3C4.
TreeFamiTF315098.

Enzyme and pathway databases

ReactomeiR-HSA-6782315. tRNA modification in the nucleus and cytosol.

Miscellaneous databases

ChiTaRSiTPRKB. human.
EvolutionaryTraceiQ9Y3C4.
GenomeRNAii51002.
PROiQ9Y3C4.
SOURCEiSearch...

Gene expression databases

BgeeiQ9Y3C4.
CleanExiHS_TPRKB.
GenevisibleiQ9Y3C4. HS.

Family and domain databases

InterProiIPR013926. CGI121/TPRKB.
[Graphical view]
PANTHERiPTHR15840. PTHR15840. 1 hit.
PfamiPF08617. CGI-121. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of CGI-121, a novel PRPK (p53-related protein kinase)-binding protein."
    Miyoshi A., Kito K., Aramoto T., Abe Y., Kobayashi N., Ueda N.
    Biochem. Biophys. Res. Commun. 303:399-405(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), SUBCELLULAR LOCATION, INTERACTION WITH TP53RK, TISSUE SPECIFICITY.
  2. Mao Y.M., Xie Y., Mu Z.M., Li Y., Huang Y.
    Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Fetal brain.
  3. "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
    Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
    Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "The human EKC/KEOPS complex is recruited to Cullin2 ubiquitin ligases by the human tumour antigen PRAME."
    Costessi A., Mahrour N., Sharma V., Stunnenberg R., Stoel M.A., Tijchon E., Conaway J.W., Conaway R.C., Stunnenberg H.G.
    PLoS ONE 7:E42822-E42822(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE EKC/KEOPS COMPLEX, SUBCELLULAR LOCATION.
  9. Cited for: X-RAY CRYSTALLOGRAPHY (2.48 ANGSTROMS).

Entry informationi

Entry nameiTPRKB_HUMAN
AccessioniPrimary (citable) accession number: Q9Y3C4
Secondary accession number(s): D6W5H6
, Q8IWR6, Q8IWR7, Q9H3K4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 6, 2007
Last sequence update: November 1, 1999
Last modified: July 6, 2016
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.