Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

EKC/KEOPS complex subunit TPRKB

Gene

TPRKB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. TPRKB acts as an allosteric effector that regulates the t6A activity of the complex. TPRKB is not required for tRNA modification (By similarity).By similarity

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

tRNA processing

Enzyme and pathway databases

ReactomeiR-HSA-6782315. tRNA modification in the nucleus and cytosol.

Names & Taxonomyi

Protein namesi
Recommended name:
EKC/KEOPS complex subunit TPRKB
Alternative name(s):
PRPK-binding protein
TP53RK-binding protein
Gene namesi
Name:TPRKB
ORF Names:CGI-121, My019
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:24259. TPRKB.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HPA
  • cytosol Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000144034.
PharmGKBiPA143485660.

Polymorphism and mutation databases

BioMutaiTPRKB.
DMDMi74735252.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002792201 – 175EKC/KEOPS complex subunit TPRKBAdd BLAST175

Proteomic databases

EPDiQ9Y3C4.
PaxDbiQ9Y3C4.
PeptideAtlasiQ9Y3C4.
PRIDEiQ9Y3C4.

PTM databases

iPTMnetiQ9Y3C4.
PhosphoSitePlusiQ9Y3C4.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000144034.
CleanExiHS_TPRKB.
GenevisibleiQ9Y3C4. HS.

Organism-specific databases

HPAiHPA035712.

Interactioni

Subunit structurei

Component of the EKC/KEOPS complex composed of at least TP53RK, TPRKB, OSGEP and LAGE3; the whole complex dimerizes. Interacts with TP53RK/PRPK.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
TP53RKQ96S443EBI-750123,EBI-739588
TRIM27P143733EBI-750123,EBI-719493

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi119210. 42 interactors.
IntActiQ9Y3C4. 3 interactors.
MINTiMINT-1451673.
STRINGi9606.ENSP00000272424.

Structurei

Secondary structure

1175
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi3 – 6Combined sources4
Beta strandi14 – 22Combined sources9
Helixi26 – 35Combined sources10
Beta strandi40 – 43Combined sources4
Helixi45 – 47Combined sources3
Helixi51 – 65Combined sources15
Turni66 – 68Combined sources3
Beta strandi71 – 74Combined sources4
Helixi75 – 83Combined sources9
Beta strandi85 – 87Combined sources3
Helixi89 – 96Combined sources8
Beta strandi103 – 111Combined sources9
Helixi120 – 123Combined sources4
Beta strandi126 – 131Combined sources6
Helixi133 – 138Combined sources6
Helixi142 – 149Combined sources8
Helixi158 – 171Combined sources14

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3ENPX-ray2.48A/B1-175[»]
ProteinModelPortaliQ9Y3C4.
SMRiQ9Y3C4.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9Y3C4.

Family & Domainsi

Sequence similaritiesi

Belongs to the CGI121/TPRKB family.Curated

Phylogenomic databases

eggNOGiKOG4066. Eukaryota.
ENOG4111MCN. LUCA.
GeneTreeiENSGT00390000012942.
HOGENOMiHOG000272647.
HOVERGENiHBG056797.
InParanoidiQ9Y3C4.
KOiK15901.
OMAiLQPDPYD.
OrthoDBiEOG091G0SS4.
PhylomeDBiQ9Y3C4.
TreeFamiTF315098.

Family and domain databases

InterProiIPR013926. CGI121/TPRKB.
[Graphical view]
PANTHERiPTHR15840. PTHR15840. 1 hit.
PfamiPF08617. CGI-121. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y3C4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQLTHQLDLF PECRVTLLLF KDVKNAGDLR RKAMEGTIDG SLINPTVIVD
60 70 80 90 100
PFQILVAANK AVHLYKLGKM KTRTLSTEII FNLSPNNNIS EALKKFGISA
110 120 130 140 150
NDTSILIVYI EEGEKQINQE YLISQVEGHQ VSLKNLPEIM NITEVKKIYK
160 170
LSSQEESIGT LLDAIICRMS TKDVL
Length:175
Mass (Da):19,661
Last modified:November 1, 1999 - v1
Checksum:iFB13C0923148C157
GO
Isoform 2 (identifier: Q9Y3C4-2) [UniParc]FASTAAdd to basket
Also known as: S1

The sequence of this isoform differs from the canonical sequence as follows:
     15-47: Missing.

Show »
Length:142
Mass (Da):16,093
Checksum:i12388A00E0205E07
GO
Isoform 3 (identifier: Q9Y3C4-3) [UniParc]FASTAAdd to basket
Also known as: L1

The sequence of this isoform differs from the canonical sequence as follows:
     47-47: V → VFHSCCPGWSAMARSWLTATSASRVQAIVLPQPPELLGLQ

Show »
Length:214
Mass (Da):23,854
Checksum:i8961692D7DF630C7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti147K → R in AAG43133 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02341415 – 47Missing in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_02341547V → VFHSCCPGWSAMARSWLTAT SASRVQAIVLPQPPELLGLQ in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY157986 mRNA. Translation: AAN76356.1.
AY157987 mRNA. Translation: AAN76357.1.
AF060921 mRNA. Translation: AAG43133.1.
AF151879 mRNA. Translation: AAD34116.1.
CH471053 Genomic DNA. Translation: EAW99720.1.
CH471053 Genomic DNA. Translation: EAW99722.1.
BC029492 mRNA. Translation: AAH29492.1.
CCDSiCCDS1927.1. [Q9Y3C4-1]
CCDS82471.1. [Q9Y3C4-3]
RefSeqiNP_001317315.1. NM_001330386.1.
NP_001317316.1. NM_001330387.1.
NP_001317317.1. NM_001330388.1.
NP_001317318.1. NM_001330389.1.
NP_001317320.1. NM_001330391.1.
NP_001317321.1. NM_001330392.1.
NP_057142.1. NM_016058.3. [Q9Y3C4-1]
XP_006712090.1. XM_006712027.3. [Q9Y3C4-3]
XP_011531179.1. XM_011532877.2. [Q9Y3C4-3]
XP_011531180.1. XM_011532878.2. [Q9Y3C4-3]
XP_016859721.1. XM_017004232.1. [Q9Y3C4-3]
XP_016859722.1. XM_017004233.1. [Q9Y3C4-3]
XP_016859723.1. XM_017004234.1. [Q9Y3C4-1]
UniGeneiHs.157401.

Genome annotation databases

EnsembliENST00000272424; ENSP00000272424; ENSG00000144034. [Q9Y3C4-1]
ENST00000318190; ENSP00000325398; ENSG00000144034. [Q9Y3C4-3]
ENST00000409716; ENSP00000386936; ENSG00000144034. [Q9Y3C4-3]
GeneIDi51002.
KEGGihsa:51002.
UCSCiuc002sjn.3. human. [Q9Y3C4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY157986 mRNA. Translation: AAN76356.1.
AY157987 mRNA. Translation: AAN76357.1.
AF060921 mRNA. Translation: AAG43133.1.
AF151879 mRNA. Translation: AAD34116.1.
CH471053 Genomic DNA. Translation: EAW99720.1.
CH471053 Genomic DNA. Translation: EAW99722.1.
BC029492 mRNA. Translation: AAH29492.1.
CCDSiCCDS1927.1. [Q9Y3C4-1]
CCDS82471.1. [Q9Y3C4-3]
RefSeqiNP_001317315.1. NM_001330386.1.
NP_001317316.1. NM_001330387.1.
NP_001317317.1. NM_001330388.1.
NP_001317318.1. NM_001330389.1.
NP_001317320.1. NM_001330391.1.
NP_001317321.1. NM_001330392.1.
NP_057142.1. NM_016058.3. [Q9Y3C4-1]
XP_006712090.1. XM_006712027.3. [Q9Y3C4-3]
XP_011531179.1. XM_011532877.2. [Q9Y3C4-3]
XP_011531180.1. XM_011532878.2. [Q9Y3C4-3]
XP_016859721.1. XM_017004232.1. [Q9Y3C4-3]
XP_016859722.1. XM_017004233.1. [Q9Y3C4-3]
XP_016859723.1. XM_017004234.1. [Q9Y3C4-1]
UniGeneiHs.157401.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3ENPX-ray2.48A/B1-175[»]
ProteinModelPortaliQ9Y3C4.
SMRiQ9Y3C4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119210. 42 interactors.
IntActiQ9Y3C4. 3 interactors.
MINTiMINT-1451673.
STRINGi9606.ENSP00000272424.

PTM databases

iPTMnetiQ9Y3C4.
PhosphoSitePlusiQ9Y3C4.

Polymorphism and mutation databases

BioMutaiTPRKB.
DMDMi74735252.

Proteomic databases

EPDiQ9Y3C4.
PaxDbiQ9Y3C4.
PeptideAtlasiQ9Y3C4.
PRIDEiQ9Y3C4.

Protocols and materials databases

DNASUi51002.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000272424; ENSP00000272424; ENSG00000144034. [Q9Y3C4-1]
ENST00000318190; ENSP00000325398; ENSG00000144034. [Q9Y3C4-3]
ENST00000409716; ENSP00000386936; ENSG00000144034. [Q9Y3C4-3]
GeneIDi51002.
KEGGihsa:51002.
UCSCiuc002sjn.3. human. [Q9Y3C4-1]

Organism-specific databases

CTDi51002.
GeneCardsiTPRKB.
HGNCiHGNC:24259. TPRKB.
HPAiHPA035712.
MIMi608680. gene.
neXtProtiNX_Q9Y3C4.
OpenTargetsiENSG00000144034.
PharmGKBiPA143485660.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4066. Eukaryota.
ENOG4111MCN. LUCA.
GeneTreeiENSGT00390000012942.
HOGENOMiHOG000272647.
HOVERGENiHBG056797.
InParanoidiQ9Y3C4.
KOiK15901.
OMAiLQPDPYD.
OrthoDBiEOG091G0SS4.
PhylomeDBiQ9Y3C4.
TreeFamiTF315098.

Enzyme and pathway databases

ReactomeiR-HSA-6782315. tRNA modification in the nucleus and cytosol.

Miscellaneous databases

ChiTaRSiTPRKB. human.
EvolutionaryTraceiQ9Y3C4.
GenomeRNAii51002.
PROiQ9Y3C4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000144034.
CleanExiHS_TPRKB.
GenevisibleiQ9Y3C4. HS.

Family and domain databases

InterProiIPR013926. CGI121/TPRKB.
[Graphical view]
PANTHERiPTHR15840. PTHR15840. 1 hit.
PfamiPF08617. CGI-121. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTPRKB_HUMAN
AccessioniPrimary (citable) accession number: Q9Y3C4
Secondary accession number(s): D6W5H6
, Q8IWR6, Q8IWR7, Q9H3K4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 6, 2007
Last sequence update: November 1, 1999
Last modified: November 30, 2016
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.