Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thioredoxin-related transmembrane protein 2

Gene

TMX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:G66-32948-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Thioredoxin-related transmembrane protein 2
Alternative name(s):
Cell proliferation-inducing gene 26 protein
Thioredoxin domain-containing protein 14
Gene namesi
Name:TMX2
Synonyms:TXNDC14
ORF Names:CGI-31, My009, PIG26, PSEC0045, UNQ237/PRO270
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:30739. TMX2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini49 – 102ExtracellularSequence analysisAdd BLAST54
Transmembranei103 – 125HelicalSequence analysisAdd BLAST23
Topological domaini126 – 296CytoplasmicSequence analysisAdd BLAST171

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi51075.
OpenTargetsiENSG00000213593.
PharmGKBiPA164726611.

Polymorphism and mutation databases

BioMutaiTMX2.
DMDMi74735249.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 48Sequence analysisAdd BLAST48
ChainiPRO_000031575249 – 296Thioredoxin-related transmembrane protein 2Add BLAST248

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei211PhosphoserineCombined sources1
Modified residuei243PhosphoserineCombined sources1
Modified residuei288PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9Y320.
PaxDbiQ9Y320.
PeptideAtlasiQ9Y320.
PRIDEiQ9Y320.

PTM databases

iPTMnetiQ9Y320.
PhosphoSitePlusiQ9Y320.
SwissPalmiQ9Y320.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000213593.
CleanExiHS_TXNDC14.
ExpressionAtlasiQ9Y320. baseline and differential.
GenevisibleiQ9Y320. HS.

Organism-specific databases

HPAiHPA040282.
HPA063763.

Interactioni

Protein-protein interaction databases

BioGridi119266. 23 interactors.
IntActiQ9Y320. 8 interactors.
MINTiMINT-6945923.
STRINGi9606.ENSP00000278422.

Structurei

Secondary structure

1296
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi145 – 152Combined sources8
Beta strandi158 – 162Combined sources5
Turni169 – 173Combined sources5
Helixi174 – 184Combined sources11
Beta strandi186 – 188Combined sources3
Beta strandi190 – 193Combined sources4
Turni196 – 198Combined sources3
Helixi200 – 205Combined sources6
Beta strandi212 – 215Combined sources4
Beta strandi217 – 233Combined sources17
Beta strandi237 – 239Combined sources3
Helixi248 – 255Combined sources8
Helixi257 – 260Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DJ0NMR-A137-260[»]
ProteinModelPortaliQ9Y320.
SMRiQ9Y320.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9Y320.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini114 – 269ThioredoxinPROSITE-ProRule annotationAdd BLAST156

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi293 – 296Di-lysine motif4

Domaini

The thioredoxin domain lacks the 2 redox-active cysteines, suggesting that it lacks thioredoxin activity.By similarity
The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins.By similarity

Sequence similaritiesi

Contains 1 thioredoxin domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0914. Eukaryota.
ENOG410XVTA. LUCA.
GeneTreeiENSGT00390000003751.
InParanoidiQ9Y320.
OMAiKYNCTGL.
OrthoDBiEOG091G0G0N.
PhylomeDBiQ9Y320.
TreeFamiTF314606.

Family and domain databases

Gene3Di3.40.30.10. 1 hit.
InterProiIPR012336. Thioredoxin-like_fold.
IPR013766. Thioredoxin_domain.
[Graphical view]
PfamiPF00085. Thioredoxin. 1 hit.
[Graphical view]
SUPFAMiSSF52833. SSF52833. 1 hit.
PROSITEiPS51352. THIOREDOXIN_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y320-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVLAPLIAL VYSVPRLSRW LAQPYYLLSA LLSAAFLLVR KLPPLCHGLP
60 70 80 90 100
TQREDGNPCD FDWREVEILM FLSAIVMMKN RRSITVEQHI GNIFMFSKVA
110 120 130 140 150
NTILFFRLDI RMGLLYITLC IVFLMTCKPP LYMGPEYIKY FNDKTIDEEL
160 170 180 190 200
ERDKRVTWIV EFFANWSNDC QSFAPIYADL SLKYNCTGLN FGKVDVGRYT
210 220 230 240 250
DVSTRYKVST SPLTKQLPTL ILFQGGKEAM RRPQIDKKGR AVSWTFSEEN
260 270 280 290
VIREFNLNEL YQRAKKLSKA GDNIPEEQPV ASTPTTVSDG ENKKDK
Length:296
Mass (Da):34,038
Last modified:November 1, 1999 - v1
Checksum:iD646B16B3A5F0C6D
GO
Isoform 2 (identifier: Q9Y320-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     84-122: ITVEQHIGNIFMFSKVANTILFFRLDIRMGLLYITLCIV → M

Show »
Length:258
Mass (Da):29,642
Checksum:i961758FD51F5511B
GO

Sequence cautioni

The sequence AAG43122 differs from that shown. Reason: Frameshift at position 283.Curated
The sequence BAC11569 differs from that shown. Reason: Frameshift at position 282.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti90I → T in AAS66642 (Ref. 6) Curated1
Sequence conflicti159I → V in AAS66642 (Ref. 6) Curated1
Sequence conflicti236D → S in AAG43122 (Ref. 5) Curated1
Sequence conflicti258N → S in BAD96778 (Ref. 7) Curated1
Sequence conflicti289D → E in BAD96778 (Ref. 7) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03069684 – 122ITVEQ…TLCIV → M in isoform 2. 2 PublicationsAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF132965 mRNA. Translation: AAD27740.1.
AY358501 mRNA. Translation: AAQ88865.1.
AK297688 mRNA. Translation: BAH12650.1.
AK075359 mRNA. Translation: BAC11569.1. Frameshift.
AF059753 mRNA. Translation: AAG43122.1. Frameshift.
AY451237 mRNA. Translation: AAS66642.1.
AK223058 mRNA. Translation: BAD96778.1.
BC000666 mRNA. Translation: AAH00666.1.
BC093062 mRNA. Translation: AAH93062.1.
CCDSiCCDS44601.1. [Q9Y320-2]
CCDS7967.1. [Q9Y320-1]
RefSeqiNP_001137484.1. NM_001144012.2. [Q9Y320-2]
NP_057043.1. NM_015959.3. [Q9Y320-1]
UniGeneiHs.654965.

Genome annotation databases

EnsembliENST00000278422; ENSP00000278422; ENSG00000213593. [Q9Y320-1]
ENST00000378312; ENSP00000367562; ENSG00000213593. [Q9Y320-2]
GeneIDi51075.
KEGGihsa:51075.
UCSCiuc001nlc.3. human. [Q9Y320-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF132965 mRNA. Translation: AAD27740.1.
AY358501 mRNA. Translation: AAQ88865.1.
AK297688 mRNA. Translation: BAH12650.1.
AK075359 mRNA. Translation: BAC11569.1. Frameshift.
AF059753 mRNA. Translation: AAG43122.1. Frameshift.
AY451237 mRNA. Translation: AAS66642.1.
AK223058 mRNA. Translation: BAD96778.1.
BC000666 mRNA. Translation: AAH00666.1.
BC093062 mRNA. Translation: AAH93062.1.
CCDSiCCDS44601.1. [Q9Y320-2]
CCDS7967.1. [Q9Y320-1]
RefSeqiNP_001137484.1. NM_001144012.2. [Q9Y320-2]
NP_057043.1. NM_015959.3. [Q9Y320-1]
UniGeneiHs.654965.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DJ0NMR-A137-260[»]
ProteinModelPortaliQ9Y320.
SMRiQ9Y320.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119266. 23 interactors.
IntActiQ9Y320. 8 interactors.
MINTiMINT-6945923.
STRINGi9606.ENSP00000278422.

PTM databases

iPTMnetiQ9Y320.
PhosphoSitePlusiQ9Y320.
SwissPalmiQ9Y320.

Polymorphism and mutation databases

BioMutaiTMX2.
DMDMi74735249.

Proteomic databases

EPDiQ9Y320.
PaxDbiQ9Y320.
PeptideAtlasiQ9Y320.
PRIDEiQ9Y320.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000278422; ENSP00000278422; ENSG00000213593. [Q9Y320-1]
ENST00000378312; ENSP00000367562; ENSG00000213593. [Q9Y320-2]
GeneIDi51075.
KEGGihsa:51075.
UCSCiuc001nlc.3. human. [Q9Y320-1]

Organism-specific databases

CTDi51075.
DisGeNETi51075.
GeneCardsiTMX2.
H-InvDBHIX0079395.
HGNCiHGNC:30739. TMX2.
HPAiHPA040282.
HPA063763.
MIMi616715. gene.
neXtProtiNX_Q9Y320.
OpenTargetsiENSG00000213593.
PharmGKBiPA164726611.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0914. Eukaryota.
ENOG410XVTA. LUCA.
GeneTreeiENSGT00390000003751.
InParanoidiQ9Y320.
OMAiKYNCTGL.
OrthoDBiEOG091G0G0N.
PhylomeDBiQ9Y320.
TreeFamiTF314606.

Enzyme and pathway databases

BioCyciZFISH:G66-32948-MONOMER.

Miscellaneous databases

ChiTaRSiTMX2. human.
EvolutionaryTraceiQ9Y320.
GenomeRNAii51075.
PROiQ9Y320.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000213593.
CleanExiHS_TXNDC14.
ExpressionAtlasiQ9Y320. baseline and differential.
GenevisibleiQ9Y320. HS.

Family and domain databases

Gene3Di3.40.30.10. 1 hit.
InterProiIPR012336. Thioredoxin-like_fold.
IPR013766. Thioredoxin_domain.
[Graphical view]
PfamiPF00085. Thioredoxin. 1 hit.
[Graphical view]
SUPFAMiSSF52833. SSF52833. 1 hit.
PROSITEiPS51352. THIOREDOXIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTMX2_HUMAN
AccessioniPrimary (citable) accession number: Q9Y320
Secondary accession number(s): B7Z4R4
, Q53G73, Q561W0, Q5J7Q7, Q8NBP9, Q9H3L1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: November 1, 1999
Last modified: November 2, 2016
This is version 138 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.