Q9Y2W7 (CSEN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 118.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calsenilin Alternative name(s): A-type potassium channel modulatory protein 3 DRE-antagonist modulator Short name=DREAM Kv channel-interacting protein 3 Short name=KChIP3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 256 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Calcium-dependent transcriptional repressor that binds to the DRE element of genes including PDYN and FOS. Affinity for DNA is reduced upon binding to calcium and enhanced by binding to magnesium. Seems to be involved in nociception By similarity. Ref.1 Ref.2 Ref.3 Ref.12 Ref.13 Ref.14 Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Involved in KCND2 and probably KCND3 trafficking to the cell surface. Ref.1 Ref.2 Ref.3 Ref.12 Ref.13 Ref.14 May play a role in the regulation of PSEN2 proteolytic processing and apoptosis. Together with PSEN2 involved in modulation of beta-amyloid formation. Ref.1 Ref.2 Ref.3 Ref.12 Ref.13 Ref.14 |
| Subunit structure | Binds to DNA as a homomultimer. Dimerization is induced by binding to calcium. Component of heteromultimeric potassium channels. Interacts with KCND2 and KCND3 By similarity. Interacts with the C-terminus of PSEN1 and PSEN2 and with PSEN2 CTF subunit. Associates with KCN1. Ref.11 Ref.18 |
| Subcellular location | Cytoplasm. Cell membrane; Lipid-anchor By similarity. Endoplasmic reticulum. Golgi apparatus. Nucleus. Note: Also membrane-bound, associated with the plasma membrane By similarity. In the presence of PSEN2 associated with the endoplasmic reticulum and Golgi. The sumoylated form is present only in the nucleus. Ref.11 Ref.17 |
| Tissue specificity | Highly expressed in brain. Widely expressed at lower levels. Expression levels are elevated in brain cortex regions affected by Alzheimer disease. Ref.16 |
| Post-translational modification | Palmitoylated. Palmitoylation enhances association with the plasma membrane By similarity. Proteolytically cleaved by caspase-3. Ref.11 Phosphorylation at Ser-63 inhibits cleavage by CASP3. |
| Sequence similarities | Belongs to the recoverin family. Contains 4 EF-hand domains. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y2W7-1) Also known as: KChIP3.1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y2W7-2) Also known as: KChIP3.2; KChIP4.2; The sequence of this isoform differs from the canonical sequence as follows: 103-124: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9Y2W7-3) The sequence of this isoform differs from the canonical sequence as follows: 1-26: Missing. 27-60: KEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGS → MGIQGMELCAMAVVVLLFIAVLKQFGILEPISME |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||
Molecule processing | |||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 256 | 256 | Calsenilin | PRO_0000073814 | |||||||||||||||||||
Regions | |||||||||||||||||||||||
| Domain | 67 – 123 | 57 | EF-hand 1; degenerate | ||||||||||||||||||||
| Domain | 126 – 161 | 36 | EF-hand 2 | ||||||||||||||||||||
| Domain | 162 – 197 | 36 | EF-hand 3 | ||||||||||||||||||||
| Domain | 210 – 245 | 36 | EF-hand 4 | ||||||||||||||||||||
| Calcium binding | 175 – 186 | 12 | 1 By similarity | ||||||||||||||||||||
| Calcium binding | 223 – 234 | 12 | 2 By similarity | ||||||||||||||||||||
| Region | 243 – 256 | 14 | Interaction with KCND2 By similarity | ||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||
| Modified residue | 63 | 1 | Phosphoserine; by CK1 Ref.15 | ||||||||||||||||||||
| Lipidation | 45 | 1 | S-palmitoyl cysteine By similarity | ||||||||||||||||||||
| Lipidation | 46 | 1 | S-palmitoyl cysteine By similarity | ||||||||||||||||||||
| Cross-link | 26 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) Ref.17 | |||||||||||||||||||||
| Cross-link | 90 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) Ref.17 | |||||||||||||||||||||
Natural variations | |||||||||||||||||||||||
| Alternative sequence | 1 – 26 | 26 | Missing in isoform 3. | VSP_040982 | |||||||||||||||||||
| Alternative sequence | 27 – 60 | 34 | KEGIK…APQGS → MGIQGMELCAMAVVVLLFIA VLKQFGILEPISME in isoform 3. | VSP_040983 | |||||||||||||||||||
| Alternative sequence | 103 – 124 | 22 | Missing in isoform 2. | VSP_015040 | |||||||||||||||||||
| Natural variant | 119 | 1 | A → V. Corresponds to variant rs35658670 [ dbSNP | Ensembl ]. | VAR_048663 | |||||||||||||||||||
| Natural variant | 170 | 1 | A → S in a breast cancer sample; somatic mutation. Ref.19 | VAR_035463 | |||||||||||||||||||
| Natural variant | 179 | 1 | D → Y in a breast cancer sample; somatic mutation. Ref.19 | VAR_035464 | |||||||||||||||||||
Experimental info | |||||||||||||||||||||||
| Mutagenesis | 61 | 1 | D → A: Abolishes cleavage by caspase-3. Ref.11 | ||||||||||||||||||||
| Mutagenesis | 64 | 1 | D → A: Abolishes cleavage by caspase-3. Ref.11 | ||||||||||||||||||||
| Sequence conflict | 182 | 1 | I → V in CAB56836. Ref.2 | ||||||||||||||||||||
| Sequence conflict | 182 | 1 | I → V in CAB56835. Ref.2 | ||||||||||||||||||||
| Sequence conflict | 207 | 1 | R → Q in CAB56836. Ref.2 | ||||||||||||||||||||
| Sequence conflict | 207 | 1 | R → Q in CAB56835. Ref.2 | ||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||
| Helix | 164 – 174 | 11 | |||||||||||||||||||||
| Beta strand | 179 – 182 | 4 | |||||||||||||||||||||
| Helix | 184 – 193 | 10 | |||||||||||||||||||||
| Beta strand | 211 – 213 | 3 | |||||||||||||||||||||
| Helix | 214 – 222 | 9 | |||||||||||||||||||||
| Beta strand | 227 – 231 | 5 | |||||||||||||||||||||
| Helix | 232 – 239 | 8 | |||||||||||||||||||||
| Helix | 243 – 254 | 12 | |||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Calsenilin: a calcium-binding protein that interacts with the presenilins and regulates the levels of a presenilin fragment." Buxbaum J.D., Choi E.K., Luo Y., Lilliehook C., Crowley A.C., Merriam D.E., Wasco W. Nat. Med. 4:1177-1181(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION IN PRESENILIN REGULATION. |
| [2] | "DREAM is a Ca2+-regulated transcriptional repressor." Carrion A.M., Link W.A., Ledo F., Mellstrom B., Naranjo J.R. Nature 398:80-84(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION IN TRANSCRIPTION REGULATION. Tissue: Caudate nucleus. |
| [3] | "Modulation of A-type potassium channels by a family of calcium sensors." An W.F., Bowlby M.R., Betty M., Cao J., Ling H.-P., Mendoza G., Hinson J.W., Mattsson K.I., Strassle B.W., Trimmer J.S., Rhodes K.J. Nature 403:553-556(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION IN POTASSIUM TRANSPORT. |
| [4] | "Structure, alternative splicing, and expression of the human and mouse KCNIP gene family." Pruunsild P., Timmusk T. Genomics 86:581-593(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), ALTERNATIVE SPLICING. |
| [5] | Isbrandt D., Pongs O. Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [6] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [8] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [11] | "Calsenilin is a substrate for caspase-3 that preferentially interacts with the familial Alzheimer's disease-associated C-terminal fragment of presenilin 2." Choi E.K., Zaidi N.F., Miller J.S., Crowley A.C., Merriam D.E., Lilliehook C., Buxbaum J.D., Wasco W. J. Biol. Chem. 276:19197-19204(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PSEN2, SUBCELLULAR LOCATION, PROTEOLYTIC PROCESSING, MUTAGENESIS OF ASP-61 AND ASP-64. |
| [12] | "Pro-apoptotic function of calsenilin/DREAM/KChIP3." Jo D.G., Kim M.J., Choi Y.H., Kim I.K., Song Y.H., Woo H.N., Chung C.W., Jung Y.K. FASEB J. 15:589-591(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN APOPTOSIS. |
| [13] | "Calsenilin enhances apoptosis by altering endoplasmic reticulum calcium signaling." Lilliehook C., Chan S., Choi E.K., Zaidi N.F., Wasco W., Mattson M.P., Buxbaum J.D. Mol. Cell. Neurosci. 19:552-559(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN APOPTOSIS. |
| [14] | "A fundamental role for KChIPs in determining the molecular properties and trafficking of Kv4.2 potassium channels." Shibata R., Misonou H., Campomanes C.R., Anderson A.E., Schrader L.A., Doliveira L.C., Carroll K.I., Sweatt J.D., Rhodes K.J., Trimmer J.S. J. Biol. Chem. 278:36445-36454(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN POTASSIUM TRANSPORT. |
| [15] | "Phosphorylation of calsenilin at Ser63 regulates its cleavage by caspase-3." Choi E.K., Miller J.S., Zaidi N.F., Salih E., Buxbaum J.D., Wasco W. Mol. Cell. Neurosci. 23:495-506(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-63. |
| [16] | "Induction of pro-apoptotic calsenilin/DREAM/KChIP3 in Alzheimer's disease and cultured neurons after amyloid-beta exposure." Jo D.G., Lee J.Y., Hong Y.M., Song S., Mook-Jung I., Koh J.Y., Jung Y.K. J. Neurochem. 88:604-611(2004) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [17] | "Sumoylation regulates nuclear localization of repressor DREAM." Palczewska M., Casafont I., Ghimire K., Rojas A.M., Valencia A., Lafarga M., Mellstrom B., Naranjo J.R. Biochim. Biophys. Acta 1813:1050-1058(2011) [PubMed] [Europe PMC] [Abstract] Cited for: SUMOYLATION AT LYS-26 AND LYS-90, SUBCELLULAR LOCATION. |
| [18] | "Solution structure and calcium-binding properties of EF-hands 3 and 4 of calsenilin." Yu L., Sun C., Mendoza R., Wang J., Matayoshi E.D., Hebert E., Pereda-Lopez A., Hajduk P.J., Olejniczak E.T. Protein Sci. 16:2502-2509(2007) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 161-256, SUBUNIT, CALCIUM-BINDING. |
| [19] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-170 AND TYR-179. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF120102 mRNA. Translation: AAD20350.1. AJ131730 mRNA. Translation: CAB56836.1. AJ131730 mRNA. Translation: CAB56835.1. AF199599 mRNA. Translation: AAF33684.1. DQ148485 mRNA. Translation: AAZ77802.1. DQ148486 mRNA. Translation: AAZ77803.1. AF367022 mRNA. Translation: AAK53711.1. BT020075 mRNA. Translation: AAV38878.1. AK315437 mRNA. Translation: BAG37825.1. AC009238 Genomic DNA. Translation: AAY14752.1. CH471219 Genomic DNA. Translation: EAX10724.1. BC012850 mRNA. Translation: AAH12850.1. | ||||||||||||
| IPI | IPI00045895. IPI00294320. IPI00651627. | ||||||||||||
| RefSeq | NP_001030086.1. NM_001034914.1. NP_038462.1. NM_013434.4. | ||||||||||||
| UniGene | Hs.437376. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9Y2W7. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9Y2W7. 1 interaction. | ||||||||||||
| MINT | MINT-1453732. | ||||||||||||
| STRING | 9606.ENSP00000295225. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9Y2W7. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 13431428. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9Y2W7. | ||||||||||||
| PRIDE | Q9Y2W7. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 30818. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000295225; ENSP00000295225; ENSG00000115041. ENST00000468529; ENSP00000417499; ENSG00000115041. | ||||||||||||
| GeneID | 30818. | ||||||||||||
| KEGG | hsa:30818. | ||||||||||||
| UCSC | uc002sup.3. human. uc002suq.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 30818. | ||||||||||||
| GeneCards | GC02P095963. | ||||||||||||
| HGNC | HGNC:15523. KCNIP3. | ||||||||||||
| HPA | CAB006907. | ||||||||||||
| MIM | 604662. gene. | ||||||||||||
| neXtProt | NX_Q9Y2W7. | ||||||||||||
| PharmGKB | PA26934. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG5126. | ||||||||||||
| HOGENOM | HOG000233019. | ||||||||||||
| HOVERGEN | HBG108179. | ||||||||||||
| InParanoid | Q9Y2W7. | ||||||||||||
| OMA | MGIQGME. | ||||||||||||
| OrthoDB | EOG4K6G52. | ||||||||||||
| PhylomeDB | Q9Y2W7. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9Y2W7. | ||||||||||||
| Bgee | Q9Y2W7. | ||||||||||||
| CleanEx | HS_KCNIP3. | ||||||||||||
| Genevestigator | Q9Y2W7. | ||||||||||||
| GermOnline | ENSG00000115041. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.238.10. 3 hits. | ||||||||||||
| InterPro | IPR011992. EF-hand-like_dom. IPR018247. EF_Hand_1_Ca_BS. IPR002048. EF_hand_dom. IPR001125. Recoverin. [Graphical view] | ||||||||||||
| Pfam | PF13499. EF_hand_5. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00450. RECOVERIN. | ||||||||||||
| SMART | SM00054. EFh. 3 hits. [Graphical view] | ||||||||||||
| PROSITE | PS00018. EF_HAND_1. 2 hits. PS50222. EF_HAND_2. 3 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q9Y2W7. | ||||||||||||
| GenomeRNAi | 30818. | ||||||||||||
| NextBio | 35528162. | ||||||||||||
| PMAP-CutDB | Q3YAC3. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | CSEN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y2W7 Secondary accession number(s): H7BY46 Q9UJ85 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
