Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glutathione S-transferase kappa 1

Gene

GSTK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).

Catalytic activityi

RX + glutathione = HX + R-S-glutathione.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei53Glutathione1 Publication1
Binding sitei183Glutathione; via amide nitrogen and carbonyl oxygen1 Publication1

GO - Molecular functioni

  • glutathione peroxidase activity Source: UniProtKB
  • glutathione transferase activity Source: UniProtKB
  • protein disulfide oxidoreductase activity Source: InterPro
  • receptor binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Transferase

Enzyme and pathway databases

BioCyciZFISH:HS02868-MONOMER.
ReactomeiR-HSA-156590. Glutathione conjugation.

Names & Taxonomyi

Protein namesi
Recommended name:
Glutathione S-transferase kappa 1 (EC:2.5.1.18)
Alternative name(s):
GST 13-13
GST class-kappa
GSTK1-1
Short name:
hGSTK1
Glutathione S-transferase subunit 13
Gene namesi
Name:GSTK1
ORF Names:HDCMD47P
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:16906. GSTK1.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • intracellular Source: LIFEdb
  • intracellular membrane-bounded organelle Source: HPA
  • membrane Source: UniProtKB
  • mitochondrial inner membrane Source: Ensembl
  • mitochondrial matrix Source: Reactome
  • mitochondrion Source: GO_Central
  • peroxisome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Peroxisome

Pathology & Biotechi

Organism-specific databases

DisGeNETi373156.
OpenTargetsiENSG00000197448.
PharmGKBiPA134948237.

Chemistry databases

ChEMBLiCHEMBL4491.
DrugBankiDB00143. Glutathione.

Polymorphism and mutation databases

BioMutaiGSTK1.
DMDMi12643338.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00001858912 – 226Glutathione S-transferase kappa 1Add BLAST225

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei49N6-succinyllysineBy similarity1
Modified residuei71N6-acetyllysineCombined sources1
Modified residuei85N6-acetyllysineBy similarity1
Modified residuei116N6-acetyllysine; alternateBy similarity1
Modified residuei116N6-succinyllysine; alternateBy similarity1
Modified residuei144N6-succinyllysineBy similarity1
Modified residuei158N6-acetyllysine; alternateBy similarity1
Modified residuei158N6-succinyllysine; alternateBy similarity1
Modified residuei165N6-acetyllysineBy similarity1
Modified residuei169N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9Y2Q3.
PeptideAtlasiQ9Y2Q3.
PRIDEiQ9Y2Q3.
TopDownProteomicsiQ9Y2Q3-1. [Q9Y2Q3-1]
Q9Y2Q3-2. [Q9Y2Q3-2]
Q9Y2Q3-4. [Q9Y2Q3-4]

PTM databases

iPTMnetiQ9Y2Q3.
PhosphoSitePlusiQ9Y2Q3.
SwissPalmiQ9Y2Q3.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000197448.
CleanExiHS_GSTK1.
ExpressionAtlasiQ9Y2Q3. baseline and differential.
GenevisibleiQ9Y2Q3. HS.

Organism-specific databases

HPAiHPA006311.
HPA022904.

Interactioni

Subunit structurei

Homodimer.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CCNDBP1O952733EBI-1053767,EBI-748961
FAM9BQ8IZU03EBI-1053767,EBI-10175124

GO - Molecular functioni

  • receptor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi131875. 51 interactors.
DIPiDIP-46924N.
IntActiQ9Y2Q3. 12 interactors.
MINTiMINT-3084797.

Chemistry databases

BindingDBiQ9Y2Q3.

Structurei

Secondary structure

1226
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi6 – 12Combined sources7
Helixi17 – 29Combined sources13
Turni30 – 32Combined sources3
Beta strandi33 – 41Combined sources9
Helixi44 – 47Combined sources4
Beta strandi57 – 59Combined sources3
Helixi61 – 77Combined sources17
Helixi88 – 94Combined sources7
Helixi97 – 109Combined sources13
Helixi111 – 113Combined sources3
Helixi114 – 126Combined sources13
Helixi135 – 144Combined sources10
Helixi149 – 156Combined sources8
Turni157 – 160Combined sources4
Helixi162 – 177Combined sources16
Beta strandi181 – 183Combined sources3
Beta strandi185 – 190Combined sources6
Beta strandi193 – 201Combined sources9
Helixi203 – 210Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1YZXX-ray1.93A/B1-226[»]
3RPNX-ray1.90A/B/C/D/E/F1-226[»]
3RPPX-ray1.80A/B/C1-226[»]
ProteinModelPortaliQ9Y2Q3.
SMRiQ9Y2Q3.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9Y2Q3.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni16 – 18Glutathione binding3
Regioni200 – 201Glutathione binding2

Sequence similaritiesi

Belongs to the GST superfamily. Kappa family.Curated

Phylogenomic databases

GeneTreeiENSGT00440000033697.
HOGENOMiHOG000219769.
HOVERGENiHBG051852.
InParanoidiQ9Y2Q3.
KOiK13299.
OMAiELWRRIW.
OrthoDBiEOG091G0LCM.
PhylomeDBiQ9Y2Q3.
TreeFamiTF105323.

Family and domain databases

Gene3Di3.40.30.10. 1 hit.
InterProiIPR001853. DSBA-like_thioredoxin_dom.
IPR014440. HCCAis_GSTk.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PfamiPF01323. DSBA. 1 hit.
[Graphical view]
PIRSFiPIRSF006386. HCCAis_GSTk. 1 hit.
SUPFAMiSSF52833. SSF52833. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y2Q3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGPLPRTVEL FYDVLSPYSW LGFEILCRYQ NIWNINLQLR PSLITGIMKD
60 70 80 90 100
SGNKPPGLLP RKGLYMANDL KLLRHHLQIP IHFPKDFLSV MLEKGSLSAM
110 120 130 140 150
RFLTAVNLEH PEMLEKASRE LWMRVWSRNE DITEPQSILA AAEKAGMSAE
160 170 180 190 200
QAQGLLEKIA TPKVKNQLKE TTEAACRYGA FGLPITVAHV DGQTHMLFGS
210 220
DRMELLAHLL GEKWMGPIPP AVNARL
Length:226
Mass (Da):25,497
Last modified:January 23, 2007 - v3
Checksum:iD3FDAFD1533B58A4
GO
Isoform 2 (identifier: Q9Y2Q3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-128: R → RVSVGLWESSGRTLDDFLTFPRHVFRVMILPPPGGSTVLPVTPLSPHRLPAVFSSSQ

Show »
Length:282
Mass (Da):31,566
Checksum:i6F88B28A6081324D
GO
Isoform 3 (identifier: Q9Y2Q3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-140: Missing.

Show »
Length:214
Mass (Da):24,185
Checksum:iFA98AC407CF8FB7B
GO
Isoform 4 (identifier: Q9Y2Q3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     52-94: Missing.

Show »
Length:183
Mass (Da):20,538
Checksum:i2AA664FBDBB510C9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti51S → R in BAG61794 (PubMed:14702039).Curated1
Sequence conflicti171T → A in BAG61794 (PubMed:14702039).Curated1
Sequence conflicti179G → R in AAF65506 (Ref. 4) Curated1
Sequence conflicti206L → V in AAP97160 (Ref. 5) Curated1
Sequence conflicti220P → S in AAF65506 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04097852 – 94Missing in isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_040025128R → RVSVGLWESSGRTLDDFLTF PRHVFRVMILPPPGGSTVLP VTPLSPHRLPAVFSSSQ in isoform 2. 2 Publications1
Alternative sequenceiVSP_040979129 – 140Missing in isoform 3. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY520571 mRNA. Translation: AAS00610.1.
AY486465 Genomic DNA. Translation: AAS01180.1.
AF070657 mRNA. Translation: AAD20963.1.
AF068287 mRNA. Translation: AAF65506.1.
AF087849 mRNA. Translation: AAP97160.1.
AL136938 mRNA. Translation: CAB66872.1.
AK289570 mRNA. Translation: BAF82259.1.
AK295592 mRNA. Translation: BAG58483.1.
AK299968 mRNA. Translation: BAG61794.1.
AC073342 Genomic DNA. No translation available.
CH471198 Genomic DNA. Translation: EAW51877.1.
BC001231 mRNA. Translation: AAH01231.1.
BC050715 mRNA. Translation: AAH50715.1.
BC063425 mRNA. Translation: AAH63425.1.
CCDSiCCDS47730.1. [Q9Y2Q3-2]
CCDS47731.1. [Q9Y2Q3-3]
CCDS47732.1. [Q9Y2Q3-4]
CCDS5877.1. [Q9Y2Q3-1]
RefSeqiNP_001137151.1. NM_001143679.1. [Q9Y2Q3-2]
NP_001137152.1. NM_001143680.1. [Q9Y2Q3-3]
NP_001137153.1. NM_001143681.1. [Q9Y2Q3-4]
NP_057001.1. NM_015917.2. [Q9Y2Q3-1]
UniGeneiHs.390667.

Genome annotation databases

EnsembliENST00000358406; ENSP00000351181; ENSG00000197448. [Q9Y2Q3-1]
ENST00000409500; ENSP00000386944; ENSG00000197448. [Q9Y2Q3-3]
ENST00000443571; ENSP00000415813; ENSG00000197448. [Q9Y2Q3-4]
ENST00000479303; ENSP00000431049; ENSG00000197448. [Q9Y2Q3-2]
GeneIDi373156.
KEGGihsa:373156.
UCSCiuc003wci.4. human. [Q9Y2Q3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY520571 mRNA. Translation: AAS00610.1.
AY486465 Genomic DNA. Translation: AAS01180.1.
AF070657 mRNA. Translation: AAD20963.1.
AF068287 mRNA. Translation: AAF65506.1.
AF087849 mRNA. Translation: AAP97160.1.
AL136938 mRNA. Translation: CAB66872.1.
AK289570 mRNA. Translation: BAF82259.1.
AK295592 mRNA. Translation: BAG58483.1.
AK299968 mRNA. Translation: BAG61794.1.
AC073342 Genomic DNA. No translation available.
CH471198 Genomic DNA. Translation: EAW51877.1.
BC001231 mRNA. Translation: AAH01231.1.
BC050715 mRNA. Translation: AAH50715.1.
BC063425 mRNA. Translation: AAH63425.1.
CCDSiCCDS47730.1. [Q9Y2Q3-2]
CCDS47731.1. [Q9Y2Q3-3]
CCDS47732.1. [Q9Y2Q3-4]
CCDS5877.1. [Q9Y2Q3-1]
RefSeqiNP_001137151.1. NM_001143679.1. [Q9Y2Q3-2]
NP_001137152.1. NM_001143680.1. [Q9Y2Q3-3]
NP_001137153.1. NM_001143681.1. [Q9Y2Q3-4]
NP_057001.1. NM_015917.2. [Q9Y2Q3-1]
UniGeneiHs.390667.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1YZXX-ray1.93A/B1-226[»]
3RPNX-ray1.90A/B/C/D/E/F1-226[»]
3RPPX-ray1.80A/B/C1-226[»]
ProteinModelPortaliQ9Y2Q3.
SMRiQ9Y2Q3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi131875. 51 interactors.
DIPiDIP-46924N.
IntActiQ9Y2Q3. 12 interactors.
MINTiMINT-3084797.

Chemistry databases

BindingDBiQ9Y2Q3.
ChEMBLiCHEMBL4491.
DrugBankiDB00143. Glutathione.

PTM databases

iPTMnetiQ9Y2Q3.
PhosphoSitePlusiQ9Y2Q3.
SwissPalmiQ9Y2Q3.

Polymorphism and mutation databases

BioMutaiGSTK1.
DMDMi12643338.

Proteomic databases

EPDiQ9Y2Q3.
PeptideAtlasiQ9Y2Q3.
PRIDEiQ9Y2Q3.
TopDownProteomicsiQ9Y2Q3-1. [Q9Y2Q3-1]
Q9Y2Q3-2. [Q9Y2Q3-2]
Q9Y2Q3-4. [Q9Y2Q3-4]

Protocols and materials databases

DNASUi373156.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000358406; ENSP00000351181; ENSG00000197448. [Q9Y2Q3-1]
ENST00000409500; ENSP00000386944; ENSG00000197448. [Q9Y2Q3-3]
ENST00000443571; ENSP00000415813; ENSG00000197448. [Q9Y2Q3-4]
ENST00000479303; ENSP00000431049; ENSG00000197448. [Q9Y2Q3-2]
GeneIDi373156.
KEGGihsa:373156.
UCSCiuc003wci.4. human. [Q9Y2Q3-1]

Organism-specific databases

CTDi373156.
DisGeNETi373156.
GeneCardsiGSTK1.
HGNCiHGNC:16906. GSTK1.
HPAiHPA006311.
HPA022904.
MIMi602321. gene.
neXtProtiNX_Q9Y2Q3.
OpenTargetsiENSG00000197448.
PharmGKBiPA134948237.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00440000033697.
HOGENOMiHOG000219769.
HOVERGENiHBG051852.
InParanoidiQ9Y2Q3.
KOiK13299.
OMAiELWRRIW.
OrthoDBiEOG091G0LCM.
PhylomeDBiQ9Y2Q3.
TreeFamiTF105323.

Enzyme and pathway databases

BioCyciZFISH:HS02868-MONOMER.
ReactomeiR-HSA-156590. Glutathione conjugation.

Miscellaneous databases

ChiTaRSiGSTK1. human.
EvolutionaryTraceiQ9Y2Q3.
GeneWikiiGSTK1.
GenomeRNAii373156.
PROiQ9Y2Q3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000197448.
CleanExiHS_GSTK1.
ExpressionAtlasiQ9Y2Q3. baseline and differential.
GenevisibleiQ9Y2Q3. HS.

Family and domain databases

Gene3Di3.40.30.10. 1 hit.
InterProiIPR001853. DSBA-like_thioredoxin_dom.
IPR014440. HCCAis_GSTk.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PfamiPF01323. DSBA. 1 hit.
[Graphical view]
PIRSFiPIRSF006386. HCCAis_GSTk. 1 hit.
SUPFAMiSSF52833. SSF52833. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiGSTK1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y2Q3
Secondary accession number(s): B4DIH1
, B4DSY2, Q6P4H0, Q7Z520, Q9P1S4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: January 23, 2007
Last modified: November 30, 2016
This is version 154 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.