Q9Y2Q3 (GSTK1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Glutathione S-transferase kappa 1 EC=2.5.1.18 Alternative name(s): GST 13-13 GST class-kappa GSTK1-1 Short name=hGSTK1 Glutathione S-transferase subunit 13 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 226 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). |
| Catalytic activity | RX + glutathione = HX + R-S-glutathione. |
| Subunit structure | Homodimer. Ref.13 |
| Subcellular location | |
| Tissue specificity | Ubiquitous. Ref.2 |
| Sequence similarities | Belongs to the GST superfamily. Kappa family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Peroxisome |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Transferase |
| PTM | Acetylation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | glutathione metabolic process Inferred from electronic annotation. Source: Compara |
| Cellular_component | mitochondrial inner membrane Inferred from electronic annotation. Source: Compara mitochondrial matrixInferred from electronic annotation. Source: Compara peroxisomeInferred from direct assay Ref.2. Source: UniProtKB |
| Molecular_function | glutathione peroxidase activity Inferred from direct assay Ref.2. Source: UniProtKB glutathione transferase activityInferred from direct assay Ref.2. Source: UniProtKB protein disulfide oxidoreductase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y2Q3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y2Q3-2) The sequence of this isoform differs from the canonical sequence as follows: 128-128: R → RVSVGLWESSGRTLDDFLTFPRHVFRVMILPPPGGSTVLPVTPLSPHRLPAVFSSSQ | ||||||
| Isoform 3 (identifier: Q9Y2Q3-3) The sequence of this isoform differs from the canonical sequence as follows: 129-140: Missing. | ||||||
| Isoform 4 (identifier: Q9Y2Q3-4) The sequence of this isoform differs from the canonical sequence as follows: 52-94: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 226 | 225 | Glutathione S-transferase kappa 1 | PRO_0000185891 | |||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||
| Region | 16 – 18 | 3 | Glutathione binding | ||||||||||||||||||||||||||||||||||||||||
| Region | 200 – 201 | 2 | Glutathione binding | ||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||
| Binding site | 53 | 1 | Glutathione | ||||||||||||||||||||||||||||||||||||||||
| Binding site | 183 | 1 | Glutathione; via amide nitrogen and carbonyl oxygen | ||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 71 | 1 | N6-acetyllysine Ref.11 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 169 | 1 | N6-acetyllysine Ref.11 | ||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 52 – 94 | 43 | Missing in isoform 4. | VSP_040978 | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 128 | 1 | R → RVSVGLWESSGRTLDDFLTF PRHVFRVMILPPPGGSTVLP VTPLSPHRLPAVFSSSQ in isoform 2. | VSP_040025 | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 129 – 140 | 12 | Missing in isoform 3. | VSP_040979 | |||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 51 | 1 | S → R in BAG61794. Ref.6 | ||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 171 | 1 | T → A in BAG61794. Ref.6 | ||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 179 | 1 | G → R in AAF65506. Ref.4 | ||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 206 | 1 | L → V in AAP97160. Ref.5 | ||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 220 | 1 | P → S in AAF65506. Ref.4 | ||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 6 – 12 | 7 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 17 – 29 | 13 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 30 – 32 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 33 – 41 | 9 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 44 – 47 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 57 – 59 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 61 – 77 | 17 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 88 – 94 | 7 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 97 – 109 | 13 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 111 – 113 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 114 – 126 | 13 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 135 – 144 | 10 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 149 – 156 | 8 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 157 – 160 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 162 – 177 | 16 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 181 – 183 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 185 – 190 | 6 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 193 – 201 | 9 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 203 – 210 | 8 | |||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Modelling and bioinformatics studies of the human kappa class glutathione transferase predict a novel third glutathione transferase family with homology to prokaryotic 2-hydroxychromene-2-carboxylate (HCCA) isomerases." Robinson A., Huttley G.A., Booth H.S., Board P.G. Biochem. J. 379:541-552(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION. Tissue: Mammary gland. |
| [2] | "Gene and protein characterization of the human glutathione S-transferase kappa and evidence for a peroxisomal localization." Morel F., Rauch C., Petit E., Piton A., Theret N., Coles B., Guillouzo A. J. Biol. Chem. 279:16246-16253(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [3] | "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells." Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. Chen Z.Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Umbilical cord blood. |
| [4] | "A novel gene from human dendritic cell." Zhao Z., Huang X., Li N., Zhu X., Cao X. Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Dendritic cell. |
| [5] | "Cloning of a novel human cDNA homologous to rats rGSTK1-1 mRNA." Zhang M., Yu L., Zhou Y., Hu P.R., Xin Y.R., Zhao S.Y. Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4). Tissue: Cerebellum and Hippocampus. |
| [7] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Uterus. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Blood, Cervix and Pancreas. |
| [11] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-71 AND LYS-169, MASS SPECTROMETRY. |
| [12] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [13] | "Thioredoxin-like domain of human kappa class glutathione transferase reveals sequence homology and structure similarity to the theta class enzyme." Li J., Xia Z., Ding J. Protein Sci. 14:2361-2369(2005) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.93 ANGSTROMS) IN COMPLEX WITH GLUTATHIONE, SUBUNIT. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY520571 mRNA. Translation: AAS00610.1. AY486465 Genomic DNA. Translation: AAS01180.1. AF070657 mRNA. Translation: AAD20963.1. AF068287 mRNA. Translation: AAF65506.1. AF087849 mRNA. Translation: AAP97160.1. AL136938 mRNA. Translation: CAB66872.1. AK289570 mRNA. Translation: BAF82259.1. AK295592 mRNA. Translation: BAG58483.1. AK299968 mRNA. Translation: BAG61794.1. AC073342 Genomic DNA. No translation available. CH471198 Genomic DNA. Translation: EAW51877.1. BC001231 mRNA. Translation: AAH01231.1. BC050715 mRNA. Translation: AAH50715.1. BC063425 mRNA. Translation: AAH63425.1. | ||||||||||||||||||||||||
| IPI | IPI00219673. IPI00440703. IPI00909432. IPI00917714. | ||||||||||||||||||||||||
| RefSeq | NP_001137151.1. NM_001143679.1. NP_001137152.1. NM_001143680.1. NP_001137153.1. NM_001143681.1. NP_057001.1. NM_015917.2. | ||||||||||||||||||||||||
| UniGene | Hs.390667. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q9Y2Q3. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-46924N. | ||||||||||||||||||||||||
| IntAct | Q9Y2Q3. 6 interactions. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000367415. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q9Y2Q3. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 12643338. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q9Y2Q3. | ||||||||||||||||||||||||
| PRIDE | Q9Y2Q3. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 373156. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000358406; ENSP00000351181; ENSG00000197448. ENST00000409500; ENSP00000386944; ENSG00000197448. ENST00000443571; ENSP00000415813; ENSG00000197448. ENST00000479303; ENSP00000431049; ENSG00000197448. | ||||||||||||||||||||||||
| GeneID | 373156. | ||||||||||||||||||||||||
| KEGG | hsa:373156. | ||||||||||||||||||||||||
| UCSC | uc003wci.3. human. uc003wcj.3. human. uc011ksy.2. human. uc011ksz.2. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 373156. | ||||||||||||||||||||||||
| GeneCards | GC07P142942. | ||||||||||||||||||||||||
| HGNC | HGNC:16906. GSTK1. | ||||||||||||||||||||||||
| HPA | HPA006311. HPA022904. | ||||||||||||||||||||||||
| MIM | 602321. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q9Y2Q3. | ||||||||||||||||||||||||
| PharmGKB | PA134948237. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG70325. | ||||||||||||||||||||||||
| HOGENOM | HOG000219769. | ||||||||||||||||||||||||
| HOVERGEN | HBG051852. | ||||||||||||||||||||||||
| KO | K13299. | ||||||||||||||||||||||||
| OMA | MRVWSRD. | ||||||||||||||||||||||||
| PhylomeDB | Q9Y2Q3. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q9Y2Q3. | ||||||||||||||||||||||||
| Bgee | Q9Y2Q3. | ||||||||||||||||||||||||
| CleanEx | HS_GSTK1. | ||||||||||||||||||||||||
| Genevestigator | Q9Y2Q3. | ||||||||||||||||||||||||
| GermOnline | ENSG00000197448. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 3.40.30.10. 1 hit. | ||||||||||||||||||||||||
| InterPro | IPR001853. DSBA-like_thioredoxin_dom. IPR014440. HCCAis_GSTk. IPR012336. Thioredoxin-like_fold. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF01323. DSBA. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PIRSF | PIRSF006386. HCCAis_GSTk. 1 hit. | ||||||||||||||||||||||||
| SUPFAM | SSF52833. Thiordxn-like_fd. 1 hit. | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| BindingDB | Q9Y2Q3. | ||||||||||||||||||||||||
| ChEMBL | CHEMBL4491. | ||||||||||||||||||||||||
| ChiTaRS | GSTK1. human. | ||||||||||||||||||||||||
| DrugBank | DB00143. Glutathione. | ||||||||||||||||||||||||
| EvolutionaryTrace | Q9Y2Q3. | ||||||||||||||||||||||||
| GenomeRNAi | 373156. | ||||||||||||||||||||||||
| NextBio | 100114. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | GSTK1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y2Q3 Secondary accession number(s): B4DIH1 Q9P1S4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
