Q9Y2L1 (RRP44_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 133.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Exosome complex exonuclease RRP44 EC=3.1.13.- EC=3.1.26.- Alternative name(s): Protein DIS3 homolog Ribosomal RNA-processing protein 44 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 958 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. DIS3 has both 3'-5' exonuclease and endonuclease activities. Ref.11 Ref.14 |
| Cofactor | Magnesium or manganese. |
| Subunit structure | Component of the RNA exosome complex. The catalytically inactive RNA exosome core (Exo-9) complex is believed to associate with catalytic subunits EXOSC10, and DIS3 or DIS3L in cytoplasmic- and nuclear-specific RNA exosome complex forms. |
| Subcellular location | Cytoplasm. Nucleus › nucleolus. Nucleus › nucleoplasm. Nucleus. Note: Predominantly located in the nucleus. According to Ref.12, found in the nucleolus and according to Ref.14, excluded from nucleolus supporting the existence of a nucleolar RNA exosome complex devoid of DIS3. Ref.12 Ref.14 Ref.15 |
| Tissue specificity | Widely expressed. |
| Miscellaneous | The association of DIS3 with the RNA exosome complex appears to be weak explaining its absence in some complex purifications. |
| Sequence similarities | Belongs to the RNR ribonuclease family. Contains 1 PINc domain. |
| Sequence caution | The sequence BAA76852.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| EXOSC3 | Q9NQT5 | 2 | EBI-373539,EBI-371866 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y2L1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y2L1-2) The sequence of this isoform differs from the canonical sequence as follows: 78-129: DVLEDPAIRNVIVLQTVLQEVRNRSAPVYKRIRDVTNNQEKHFYTFTNEHHR → VSAWRPGTWASVASSLRLPGSL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 958 | 958 | Exosome complex exonuclease RRP44 | PRO_0000166419 | |||||
Regions | |||||||||
| Domain | 64 – 182 | 119 | PINc | ||||||
Amino acid modifications | |||||||||
| Modified residue | 18 | 1 | N6-acetyllysine Ref.13 | ||||||
Natural variations | |||||||||
| Alternative sequence | 78 – 129 | 52 | DVLED…NEHHR → VSAWRPGTWASVASSLRLPG SL in isoform 2. | VSP_014971 | |||||
| Natural variant | 269 | 1 | N → S. Ref.3 Ref.6 Ref.7 Corresponds to variant rs4883918 [ dbSNP | Ensembl ]. | VAR_023099 | |||||
| Natural variant | 326 | 1 | T → R. Ref.4 Ref.10 Corresponds to variant rs7332388 [ dbSNP | Ensembl ]. | VAR_023100 | |||||
Experimental info | |||||||||
| Mutagenesis | 146 | 1 | D → N: Loss of endonuclease activity; when associated with N-487. Ref.14 | ||||||
| Mutagenesis | 487 | 1 | D → N: Loss of exonuclease activity. Loss of endonuclease activity; when associated with N-146. Ref.14 | ||||||
| Sequence conflict | 635 | 1 | P → S in CAH56266. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human dis3p, which binds to either GTP- or GDP-Ran, complements Saccharomyces cerevisiae dis3." Shiomi T., Fukushima K., Suzuki N., Nakashima N., Noguchi E., Nishimoto T. J. Biochem. 123:883-890(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], CHARACTERIZATION. |
| [2] | Erratum Shiomi T., Fukushima K., Suzuki N., Nakashima N., Noguchi E., Nishimoto T. J. Biochem. 124:250-250(1998) |
| [3] | "A genomic map of a 6-Mb region at 13q21-q22 implicated in cancer development: identification and characterization of candidate genes." Rozenblum E., Vahteristo P., Sandberg T., Bergthorsson J.T., Syrjakoski K., Weaver D., Haraldsson K., Johannsdottir H.K., Vehmanen P., Nigam S., Golberger N., Robbins C., Pak E., Dutra A., Gillander E., Stephan D.A., Bailey-Wilson J., Juo S.-H.H. Kallioniemi O.-P.Hum. Genet. 110:111-121(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT SER-269. Tissue: Brain and Peripheral blood leukocyte. |
| [4] | "Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 6:63-70(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ARG-326. Tissue: Brain. |
| [5] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-269. Tissue: Trachea. |
| [7] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-269. Tissue: Lymph node and Testis. |
| [8] | "The DNA sequence and analysis of human chromosome 13." Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. Ross M.T.Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ARG-326. Tissue: Lymph. |
| [11] | "RNA exosome depletion reveals transcription upstream of active human promoters." Preker P., Nielsen J., Kammler S., Lykke-Andersen S., Christensen M.S., Mapendano C.K., Schierup M.H., Jensen T.H. Science 322:1851-1854(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PROMPT DEGRADATION. |
| [12] | "Functional proteomic analysis of human nucleolus." Scherl A., Coute Y., Deon C., Calle A., Kindbeiter K., Sanchez J.-C., Greco A., Hochstrasser D.F., Diaz J.-J. Mol. Biol. Cell 13:4100-4109(2002) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [13] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-18, MASS SPECTROMETRY. |
| [14] | "The human core exosome interacts with differentially localized processive RNases: hDIS3 and hDIS3L." Tomecki R., Kristiansen M.S., Lykke-Andersen S., Chlebowski A., Larsen K.M., Szczesny R.J., Drazkowska K., Pastula A., Andersen J.S., Stepien P.P., Dziembowski A., Jensen T.H. EMBO J. 29:2342-2357(2010) [PubMed] [Europe PMC] [Abstract] Cited for: ASSOCIATION WITH THE RNA EXOSOME COMPLEX, MASS SPECTROMETRY, FUNCTION, COFACTOR, SUBCELLULAR LOCATION, MUTAGENESIS OF ASP-146 AND ASP-487. |
| [15] | "Dis3-like 1: a novel exoribonuclease associated with the human exosome." Staals R.H., Bronkhorst A.W., Schilders G., Slomovic S., Schuster G., Heck A.J., Raijmakers R., Pruijn G.J. EMBO J. 29:2358-2367(2010) [PubMed] [Europe PMC] [Abstract] Cited for: ASSOCIATION WITH THE RNA EXOSOME COMPLEX, MASS SPECTROMETRY, SUBCELLULAR LOCATION, INTERACTION WITH EXOSC3. |
| [16] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF330044 mRNA. Translation: AAL37479.1. AB023225 mRNA. Translation: BAA76852.2. Different initiation. AL832266 mRNA. Translation: CAH56266.1. AK314715 mRNA. Translation: BAG37259.1. AL080158 mRNA. Translation: CAB45749.1. AL138695, AL391384 Genomic DNA. Translation: CAH72709.1. AL138695, AL391384 Genomic DNA. Translation: CAH72708.1. AL391384, AL138695 Genomic DNA. Translation: CAI15670.1. AL391384, AL138695 Genomic DNA. Translation: CAI15671.1. CH471093 Genomic DNA. Translation: EAW80517.1. BC056143 mRNA. Translation: AAH56143.1. |
| IPI | IPI00183462. IPI00746351. |
| PIR | JE0110. |
| RefSeq | NP_001121698.1. NM_001128226.1. NP_055768.3. NM_014953.3. |
| UniGene | Hs.740506. |
3D structure databases | |
| ProteinModelPortal | Q9Y2L1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9Y2L1. 8 interactions. |
PTM databases | |
| PhosphoSite | Q9Y2L1. |
Polymorphism databases | |
| DMDM | 73620993. |
2D gel databases | |
| SWISS-2DPAGE | Q9Y2L1. |
Proteomic databases | |
| PaxDb | Q9Y2L1. |
| PRIDE | Q9Y2L1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000377767; ENSP00000366997; ENSG00000083520. ENST00000377780; ENSP00000367011; ENSG00000083520. |
| GeneID | 22894. |
| KEGG | hsa:22894. |
| UCSC | uc001vix.4. human. uc001viy.4. human. |
Organism-specific databases | |
| CTD | 22894. |
| GeneCards | GC13M073329. |
| H-InvDB | HIX0011365. |
| HGNC | HGNC:20604. DIS3. |
| HPA | HPA039281. |
| MIM | 607533. gene. |
| neXtProt | NX_Q9Y2L1. |
| PharmGKB | PA162383628. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0557. |
| HOVERGEN | HBG059397. |
| InParanoid | Q9Y2L1. |
| KO | K12585. |
| OMA | MPWSITE. |
| OrthoDB | EOG45B1DT. |
| PhylomeDB | Q9Y2L1. |
Enzyme and pathway databases | |
| Reactome | REACT_21257. Metabolism of RNA. REACT_71. Gene Expression. |
Gene expression databases | |
| ArrayExpress | Q9Y2L1. |
| Bgee | Q9Y2L1. |
| CleanEx | HS_DIS3. |
| Genevestigator | Q9Y2L1. |
| GermOnline | ENSG00000083520. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002716. PIN_dom. IPR006596. PINc_nuc-bd. IPR001900. RNase_II/R. IPR022966. RNase_II/R_CS. [Graphical view] |
| Pfam | PF13638. PIN_4. 1 hit. PF00773. RNB. 1 hit. [Graphical view] |
| SMART | SM00670. PINc. 1 hit. SM00955. RNB. 1 hit. [Graphical view] |
| PROSITE | PS01175. RIBONUCLEASE_II. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | DIS3. human. |
| GenomeRNAi | 22894. |
| NextBio | 43511. |
| SOURCE | Search... |
Entry information
| Entry name | RRP44_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y2L1 Secondary accession number(s): A6NI21 Q9UG36 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 13 Human chromosome 13: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
