Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y2L1

- RRP44_HUMAN

UniProt

Q9Y2L1 - RRP44_HUMAN

Protein

Exosome complex exonuclease RRP44

Gene

DIS3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 148 (01 Oct 2014)
      Sequence version 2 (16 Aug 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. DIS3 has both 3'-5' exonuclease and endonuclease activities.2 Publications

    Cofactori

    Magnesium or manganese.1 Publication

    GO - Molecular functioni

    1. 3'-5'-exoribonuclease activity Source: UniProtKB
    2. endonuclease activity Source: UniProtKB
    3. guanyl-nucleotide exchange factor activity Source: UniProtKB
    4. protein binding Source: IntAct
    5. RNA binding Source: UniProtKB-KW

    GO - Biological processi

    1. CUT catabolic process Source: UniProtKB
    2. exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay Source: Reactome
    3. gene expression Source: Reactome
    4. mRNA metabolic process Source: Reactome
    5. nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay Source: Reactome
    6. nucleic acid phosphodiester bond hydrolysis Source: GOC
    7. positive regulation of GTPase activity Source: GOC
    8. RNA metabolic process Source: Reactome
    9. RNA phosphodiester bond hydrolysis, exonucleolytic Source: GOC
    10. rRNA catabolic process Source: UniProtKB
    11. rRNA processing Source: UniProtKB

    Keywords - Molecular functioni

    Endonuclease, Exonuclease, Hydrolase, Nuclease

    Keywords - Biological processi

    rRNA processing

    Keywords - Ligandi

    Magnesium, Manganese, RNA-binding

    Enzyme and pathway databases

    ReactomeiREACT_18355. ATF4 activates genes.
    REACT_20619. mRNA decay by 3' to 5' exoribonuclease.
    REACT_24915. Butyrate Response Factor 1 (BRF1) destabilizes mRNA.
    REACT_25042. KSRP destabilizes mRNA.
    REACT_25064. Tristetraprolin (TTP) destabilizes mRNA.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Exosome complex exonuclease RRP44 (EC:3.1.13.-, EC:3.1.26.-)
    Alternative name(s):
    Protein DIS3 homolog
    Ribosomal RNA-processing protein 44
    Gene namesi
    Name:DIS3
    Synonyms:KIAA1008, RRP44
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 13

    Organism-specific databases

    HGNCiHGNC:20604. DIS3.

    Subcellular locationi

    Cytoplasm. Nucleusnucleolus. Nucleusnucleoplasm. Nucleus
    Note: Predominantly located in the nucleus. According to PubMed:12429849, found in the nucleolus and according to PubMed:20531386, excluded from nucleolus supporting the existence of a nucleolar RNA exosome complex devoid of DIS3.

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. cytosol Source: Reactome
    3. exosome (RNase complex) Source: UniProtKB
    4. membrane Source: UniProtKB
    5. nuclear exosome (RNase complex) Source: UniProtKB
    6. nucleoplasm Source: UniProtKB
    7. nucleus Source: HPA

    Keywords - Cellular componenti

    Cytoplasm, Exosome, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi146 – 1461D → N: Loss of endonuclease activity; when associated with N-487. 1 Publication
    Mutagenesisi487 – 4871D → N: Loss of exonuclease activity. Loss of endonuclease activity; when associated with N-146. 1 Publication

    Organism-specific databases

    PharmGKBiPA162383628.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 958958Exosome complex exonuclease RRP44PRO_0000166419Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine1 Publication
    Modified residuei18 – 181N6-acetyllysine1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ9Y2L1.
    PaxDbiQ9Y2L1.
    PRIDEiQ9Y2L1.

    2D gel databases

    SWISS-2DPAGEQ9Y2L1.

    PTM databases

    PhosphoSiteiQ9Y2L1.

    Expressioni

    Tissue specificityi

    Widely expressed.

    Gene expression databases

    ArrayExpressiQ9Y2L1.
    BgeeiQ9Y2L1.
    CleanExiHS_DIS3.
    GenevestigatoriQ9Y2L1.

    Organism-specific databases

    HPAiHPA039281.

    Interactioni

    Subunit structurei

    Component of the RNA exosome complex. The catalytically inactive RNA exosome core (Exo-9) complex is believed to associate with catalytic subunits EXOSC10, and DIS3 or DIS3L in cytoplasmic- and nuclear-specific RNA exosome complex forms.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    EXOSC10Q017804EBI-373539,EBI-358236
    EXOSC3Q9NQT53EBI-373539,EBI-371866

    Protein-protein interaction databases

    BioGridi116559. 25 interactions.
    IntActiQ9Y2L1. 15 interactions.
    MINTiMINT-3034163.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Y2L1.
    SMRiQ9Y2L1. Positions 10-911.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini64 – 182119PINcAdd
    BLAST

    Sequence similaritiesi

    Belongs to the RNR ribonuclease family.Curated
    Contains 1 PINc domain.Curated

    Phylogenomic databases

    eggNOGiCOG0557.
    HOVERGENiHBG059397.
    InParanoidiQ9Y2L1.
    KOiK12585.
    OMAiENANDRN.
    OrthoDBiEOG7KH9J1.
    PhylomeDBiQ9Y2L1.
    TreeFamiTF105755.

    Family and domain databases

    Gene3Di3.40.50.1010. 1 hit.
    InterProiIPR012340. NA-bd_OB-fold.
    IPR002716. PIN_dom.
    IPR029060. PIN_domain-like.
    IPR022966. RNase_II/R_CS.
    [Graphical view]
    PfamiPF13638. PIN_4. 1 hit.
    [Graphical view]
    SMARTiSM00670. PINc. 1 hit.
    [Graphical view]
    SUPFAMiSSF50249. SSF50249. 4 hits.
    SSF88723. SSF88723. 1 hit.
    PROSITEiPS01175. RIBONUCLEASE_II. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9Y2L1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLKSKTFLKK TRAGGVMKIV REHYLRDDIG CGAPGCAACG GAHEGPALEP    50
    QPQDPASSVC PQPHYLLPDT NVLLHQIDVL EDPAIRNVIV LQTVLQEVRN 100
    RSAPVYKRIR DVTNNQEKHF YTFTNEHHRE TYVEQEQGEN ANDRNDRAIR 150
    VAAKWYNEHL KKMSADNQLQ VIFITNDRRN KEKAIEEGIP AFTCEEYVKS 200
    LTANPELIDR LACLSEEGNE IESGKIIFSE HLPLSKLQQG IKSGTYLQGT 250
    FRASRENYLE ATVWIHGDNE ENKEIILQGL KHLNRAVHED IVAVELLPKS 300
    QWVAPSSVVL HDEGQNEEDV EKEEETERML KTAVSEKMLK PTGRVVGIIK 350
    RNWRPYCGML SKSDIKESRR HLFTPADKRI PRIRIETRQA STLEGRRIIV 400
    AIDGWPRNSR YPNGHFVRNL GDVGEKETET EVLLLEHDVP HQPFSQAVLS 450
    FLPKMPWSIT EKDMKNREDL RHLCICSVDP PGCTDIDDAL HCRELENGNL 500
    EVGVHIADVS HFIRPGNALD QESARRGTTV YLCEKRIDMV PELLSSNLCS 550
    LKCDVDRLAF SCIWEMNHNA EILKTKFTKS VINSKASLTY AEAQLRIDSA 600
    NMNDDITTSL RGLNKLAKIL KKRRIEKGAL TLSSPEVRFH MDSETHDPID 650
    LQTKELRETN SMVEEFMLLA NISVAKKIHE EFSEHALLRK HPAPPPSNYE 700
    ILVKAARSRN LEIKTDTAKS LAESLDQAES PTFPYLNTLL RILATRCMMQ 750
    AVYFCSGMDN DFHHYGLASP IYTHFTSPIR RYADVIVHRL LAVAIGADCT 800
    YPELTDKHKL ADICKNLNFR HKMAQYAQRA SVAFHTQLFF KSKGIVSEEA 850
    YILFVRKNAI VVLIPKYGLE GTVFFEEKDK PNPQLIYDDE IPSLKIEDTV 900
    FHVFDKVKVK IMLDSSNLQH QKIRMSLVEP QIPGISIPTD TSNMDLNGPK 950
    KKKMKLGK 958
    Length:958
    Mass (Da):109,003
    Last modified:August 16, 2005 - v2
    Checksum:i92336BA0D06247FE
    GO
    Isoform 2 (identifier: Q9Y2L1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         78-129: DVLEDPAIRNVIVLQTVLQEVRNRSAPVYKRIRDVTNNQEKHFYTFTNEHHR → VSAWRPGTWASVASSLRLPGSL

    Show »
    Length:928
    Mass (Da):105,040
    Checksum:iEDE527578627579A
    GO

    Sequence cautioni

    The sequence BAA76852.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti635 – 6351P → S in CAH56266. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti269 – 2691N → S.3 Publications
    Corresponds to variant rs4883918 [ dbSNP | Ensembl ].
    VAR_023099
    Natural varianti326 – 3261T → R.2 Publications
    Corresponds to variant rs7332388 [ dbSNP | Ensembl ].
    VAR_023100

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei78 – 12952DVLED…NEHHR → VSAWRPGTWASVASSLRLPG SL in isoform 2. 1 PublicationVSP_014971Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF330044 mRNA. Translation: AAL37479.1.
    AB023225 mRNA. Translation: BAA76852.2. Different initiation.
    AL832266 mRNA. Translation: CAH56266.1.
    AK314715 mRNA. Translation: BAG37259.1.
    AL080158 mRNA. Translation: CAB45749.1.
    AL138695, AL391384 Genomic DNA. Translation: CAH72709.1.
    AL138695, AL391384 Genomic DNA. Translation: CAH72708.1.
    AL391384, AL138695 Genomic DNA. Translation: CAI15670.1.
    AL391384, AL138695 Genomic DNA. Translation: CAI15671.1.
    CH471093 Genomic DNA. Translation: EAW80517.1.
    BC056143 mRNA. Translation: AAH56143.1.
    CCDSiCCDS45057.1. [Q9Y2L1-2]
    CCDS9447.1. [Q9Y2L1-1]
    PIRiJE0110.
    RefSeqiNP_001121698.1. NM_001128226.2. [Q9Y2L1-2]
    NP_055768.3. NM_014953.4. [Q9Y2L1-1]
    UniGeneiHs.744104.

    Genome annotation databases

    EnsembliENST00000377767; ENSP00000366997; ENSG00000083520. [Q9Y2L1-1]
    ENST00000377780; ENSP00000367011; ENSG00000083520. [Q9Y2L1-2]
    GeneIDi22894.
    KEGGihsa:22894.
    UCSCiuc001vix.4. human. [Q9Y2L1-1]
    uc001viy.4. human. [Q9Y2L1-2]

    Polymorphism databases

    DMDMi73620993.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF330044 mRNA. Translation: AAL37479.1 .
    AB023225 mRNA. Translation: BAA76852.2 . Different initiation.
    AL832266 mRNA. Translation: CAH56266.1 .
    AK314715 mRNA. Translation: BAG37259.1 .
    AL080158 mRNA. Translation: CAB45749.1 .
    AL138695 , AL391384 Genomic DNA. Translation: CAH72709.1 .
    AL138695 , AL391384 Genomic DNA. Translation: CAH72708.1 .
    AL391384 , AL138695 Genomic DNA. Translation: CAI15670.1 .
    AL391384 , AL138695 Genomic DNA. Translation: CAI15671.1 .
    CH471093 Genomic DNA. Translation: EAW80517.1 .
    BC056143 mRNA. Translation: AAH56143.1 .
    CCDSi CCDS45057.1. [Q9Y2L1-2 ]
    CCDS9447.1. [Q9Y2L1-1 ]
    PIRi JE0110.
    RefSeqi NP_001121698.1. NM_001128226.2. [Q9Y2L1-2 ]
    NP_055768.3. NM_014953.4. [Q9Y2L1-1 ]
    UniGenei Hs.744104.

    3D structure databases

    ProteinModelPortali Q9Y2L1.
    SMRi Q9Y2L1. Positions 10-911.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116559. 25 interactions.
    IntActi Q9Y2L1. 15 interactions.
    MINTi MINT-3034163.

    PTM databases

    PhosphoSitei Q9Y2L1.

    Polymorphism databases

    DMDMi 73620993.

    2D gel databases

    SWISS-2DPAGE Q9Y2L1.

    Proteomic databases

    MaxQBi Q9Y2L1.
    PaxDbi Q9Y2L1.
    PRIDEi Q9Y2L1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000377767 ; ENSP00000366997 ; ENSG00000083520 . [Q9Y2L1-1 ]
    ENST00000377780 ; ENSP00000367011 ; ENSG00000083520 . [Q9Y2L1-2 ]
    GeneIDi 22894.
    KEGGi hsa:22894.
    UCSCi uc001vix.4. human. [Q9Y2L1-1 ]
    uc001viy.4. human. [Q9Y2L1-2 ]

    Organism-specific databases

    CTDi 22894.
    GeneCardsi GC13M073329.
    H-InvDB HIX0011365.
    HGNCi HGNC:20604. DIS3.
    HPAi HPA039281.
    MIMi 607533. gene.
    neXtProti NX_Q9Y2L1.
    PharmGKBi PA162383628.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0557.
    HOVERGENi HBG059397.
    InParanoidi Q9Y2L1.
    KOi K12585.
    OMAi ENANDRN.
    OrthoDBi EOG7KH9J1.
    PhylomeDBi Q9Y2L1.
    TreeFami TF105755.

    Enzyme and pathway databases

    Reactomei REACT_18355. ATF4 activates genes.
    REACT_20619. mRNA decay by 3' to 5' exoribonuclease.
    REACT_24915. Butyrate Response Factor 1 (BRF1) destabilizes mRNA.
    REACT_25042. KSRP destabilizes mRNA.
    REACT_25064. Tristetraprolin (TTP) destabilizes mRNA.

    Miscellaneous databases

    ChiTaRSi DIS3. human.
    GeneWikii DIS3.
    GenomeRNAii 22894.
    NextBioi 43511.
    PROi Q9Y2L1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9Y2L1.
    Bgeei Q9Y2L1.
    CleanExi HS_DIS3.
    Genevestigatori Q9Y2L1.

    Family and domain databases

    Gene3Di 3.40.50.1010. 1 hit.
    InterProi IPR012340. NA-bd_OB-fold.
    IPR002716. PIN_dom.
    IPR029060. PIN_domain-like.
    IPR022966. RNase_II/R_CS.
    [Graphical view ]
    Pfami PF13638. PIN_4. 1 hit.
    [Graphical view ]
    SMARTi SM00670. PINc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50249. SSF50249. 4 hits.
    SSF88723. SSF88723. 1 hit.
    PROSITEi PS01175. RIBONUCLEASE_II. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Human dis3p, which binds to either GTP- or GDP-Ran, complements Saccharomyces cerevisiae dis3."
      Shiomi T., Fukushima K., Suzuki N., Nakashima N., Noguchi E., Nishimoto T.
      J. Biochem. 123:883-890(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], CHARACTERIZATION.
    2. Erratum
      Shiomi T., Fukushima K., Suzuki N., Nakashima N., Noguchi E., Nishimoto T.
      J. Biochem. 124:250-250(1998)
    3. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT SER-269.
      Tissue: Brain and Peripheral blood leukocyte.
    4. "Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 6:63-70(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ARG-326.
      Tissue: Brain.
    5. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-269.
      Tissue: Trachea.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-269.
      Tissue: Lymph node and Testis.
    8. "The DNA sequence and analysis of human chromosome 13."
      Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
      Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ARG-326.
      Tissue: Lymph.
    11. "RNA exosome depletion reveals transcription upstream of active human promoters."
      Preker P., Nielsen J., Kammler S., Lykke-Andersen S., Christensen M.S., Mapendano C.K., Schierup M.H., Jensen T.H.
      Science 322:1851-1854(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN PROMPT DEGRADATION.
    12. Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
      Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
      Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-18, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. Cited for: ASSOCIATION WITH THE RNA EXOSOME COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY, FUNCTION, COFACTOR, SUBCELLULAR LOCATION, MUTAGENESIS OF ASP-146 AND ASP-487.
    15. "Dis3-like 1: a novel exoribonuclease associated with the human exosome."
      Staals R.H., Bronkhorst A.W., Schilders G., Slomovic S., Schuster G., Heck A.J., Raijmakers R., Pruijn G.J.
      EMBO J. 29:2358-2367(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: ASSOCIATION WITH THE RNA EXOSOME COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION, INTERACTION WITH EXOSC3.
    16. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    17. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiRRP44_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y2L1
    Secondary accession number(s): A6NI21
    , B2RBL2, Q5W0P7, Q5W0P8, Q658Z7, Q7Z481, Q8WWI2, Q9UG36
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: August 16, 2005
    Last modified: October 1, 2014
    This is version 148 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    The association of DIS3 with the RNA exosome complex appears to be weak explaining its absence in some complex purifications.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 13
      Human chromosome 13: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3