Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase SIK3

Gene

SIK3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Enzyme regulationi

Activated by phosphorylation on Thr-221.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei95ATPPROSITE-ProRule annotation1
Active sitei188Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi72 – 80ATPPROSITE-ProRule annotation9

GO - Molecular functioni

  • ATP binding Source: UniProtKB
  • magnesium ion binding Source: UniProtKB
  • protein serine/threonine kinase activity Source: UniProtKB

GO - Biological processi

  • protein phosphorylation Source: UniProtKB

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiQ9Y2K2.
SIGNORiQ9Y2K2.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase SIK3Curated (EC:2.7.11.1)
Alternative name(s):
Salt-inducible kinase 3
Short name:
SIK-3
Serine/threonine-protein kinase QSK
Gene namesi
Name:SIK3Imported
Synonyms:KIAA09991 Publication, QSK1 Publication
ORF Names:L19
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componentsi: Chromosome 11, Unplaced

Organism-specific databases

EuPathDBiHostDB:ENSG00000160584.15.
HGNCiHGNC:29165. SIK3.
MIMi614776. gene.
neXtProtiNX_Q9Y2K2.

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi221T → A: Prevents phosphorylation and activation by STK11/LKB1 complex. 1 Publication1

Organism-specific databases

DisGeNETi23387.
OpenTargetsiENSG00000160584.
PharmGKBiPA165543631.

Chemistry databases

ChEMBLiCHEMBL6149.
GuidetoPHARMACOLOGYi2199.

Polymorphism and mutation databases

BioMutaiSIK3.
DMDMi115502238.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002522571 – 1321Serine/threonine-protein kinase SIK3Add BLAST1321

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei71PhosphothreonineCombined sources1
Modified residuei221Phosphothreonine; by LKB1Combined sources1 Publication1
Modified residuei469PhosphothreonineCombined sources1
Modified residuei551PhosphoserineCombined sources1
Modified residuei591PhosphoserineBy similarity1
Modified residuei592PhosphoserineBy similarity1
Modified residuei626PhosphoserineCombined sources1
Modified residuei647PhosphoserineBy similarity1
Modified residuei866PhosphoserineCombined sources1
Modified residuei978PhosphoserineCombined sources1
Modified residuei986Omega-N-methylarginineBy similarity1
Isoform 2 (identifier: Q9Y2K2-6)
Modified residuei128PhosphothreonineCombined sources1

Post-translational modificationi

Phosphorylated at Thr-221 by STK11/LKB1 in complex with STE20-related adapter-alpha (STRADA) pseudo kinase and CAB39.1 Publication

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

EPDiQ9Y2K2.
MaxQBiQ9Y2K2.
PaxDbiQ9Y2K2.
PeptideAtlasiQ9Y2K2.
PRIDEiQ9Y2K2.

PTM databases

iPTMnetiQ9Y2K2.
PhosphoSitePlusiQ9Y2K2.

Expressioni

Gene expression databases

BgeeiENSG00000160584.
ExpressionAtlasiJ3KPC8. baseline and differential.

Organism-specific databases

HPAiHPA045245.
HPA048161.

Interactioni

Subunit structurei

Binds to and is activated by YWHAZ when phosphorylated on Thr-221.

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi116963. 21 interactors.
IntActiQ9Y2K2. 11 interactors.
MINTiQ9Y2K2.
STRINGi9606.ENSP00000292055.

Chemistry databases

BindingDBiQ9Y2K2.

Structurei

3D structure databases

ProteinModelPortaliQ9Y2K2.
SMRiQ9Y2K2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini66 – 317Protein kinasePROSITE-ProRule annotationAdd BLAST252
Domaini344 – 384UBAPROSITE-ProRule annotationAdd BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi2 – 54Ala-richPROSITE-ProRule annotationAdd BLAST53
Compositional biasi650 – 1016Gln-richPROSITE-ProRule annotationAdd BLAST367

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0586. Eukaryota.
ENOG410XNQ0. LUCA.
GeneTreeiENSGT00900000140806.
HOGENOMiHOG000154056.
HOVERGENiHBG079682.
InParanoidiQ9Y2K2.
KOiK19009.
PhylomeDBiQ9Y2K2.
TreeFamiTF315213.

Family and domain databases

CDDicd14071. STKc_SIK. 1 hit.
InterProiView protein in InterPro
IPR011009. Kinase-like_dom_sf.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
IPR034672. SIK.
IPR015940. UBA.
PfamiView protein in Pfam
PF00069. Pkinase. 1 hit.
SMARTiView protein in SMART
SM00220. S_TKc. 1 hit.
SUPFAMiSSF56112. SSF56112. 2 hits.
PROSITEiView protein in PROSITE
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
PS50030. UBA. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y2K2-5) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAAASGAG GAAGAGTGGA GPAGRLLPPP APGSPAAPAA VSPAAGQPRP
60 70 80 90 100
PAPASRGPMP ARIGYYEIDR TIGKGNFAVV KRATHLVTKA KVAIKIIDKT
110 120 130 140 150
QLDEENLKKI FREVQIMKML CHPHIIRLYQ VMETERMIYL VTEYASGGEI
160 170 180 190 200
FDHLVAHGRM AEKEARRKFK QIVTAVYFCH CRNIVHRDLK AENLLLDANL
210 220 230 240 250
NIKIADFGFS NLFTPGQLLK TWCGSPPYAA PELFEGKEYD GPKVDIWSLG
260 270 280 290 300
VVLYVLVCGA LPFDGSTLQN LRARVLSGKF RIPFFMSTEC EHLIRHMLVL
310 320 330 340 350
DPNKRLSMEQ ICKHKWMKLG DADPNFDRLI AECQQLKEER QVDPLNEDVL
360 370 380 390 400
LAMEDMGLDK EQTLQSLRSD AYDHYSAIYS LLCDRHKRHK TLRLGALPSM
410 420 430 440 450
PRALAFQAPV NIQAEQAGTA MNISVPQVQL INPENQIVEP DGTLNLDSDE
460 470 480 490 500
GEEPSPEALV RYLSMRRHTV GVADPRTEVM EDLQKLLPGF PGVNPQAPFL
510 520 530 540 550
QVAPNVNFMH NLLPMQNLQP TGQLEYKEQS LLQPPTLQLL NGMGPLGRRA
560 570 580 590 600
SDGGANIQLH AQQLLKRPRG PSPLVTMTPA VPAVTPVDEE SSDGEPDQEA
610 620 630 640 650
VQSSTYKDSN TLHLPTERFS PVRRFSDGAA SIQAFKAHLE KMGNNSSIKQ
660 670 680 690 700
LQQECEQLQK MYGGQIDERT LEKTQQQHML YQQEQHHQIL QQQIQDSICP
710 720 730 740 750
PQPSPPLQAA CENQPALLTH QLQRLRIQPS SPPPNHPNNH LFRQPSNSPP
760 770 780 790 800
PMSSAMIQPH GAASSSQFQG LPSRSAIFQQ QPENCSSPPN VALTCLGMQQ
810 820 830 840 850
PAQSQQVTIQ VQEPVDMLSN MPGTAAGSSG RGISISPSAG QMQMQHRTNL
860 870 880 890 900
MATLSYGHRP LSKQLSADSA EAHSLNVNRF SPANYDQAHL HPHLFSDQSR
910 920 930 940 950
GSPSSYSPST GVGFSPTQAL KVPPLDQFPT FPPSAHQQPP HYTTSALQQA
960 970 980 990 1000
LLSPTPPDYT RHQQVPHILQ GLLSPRHSLT GHSDIRLPPT EFAQLIKRQQ
1010 1020 1030 1040 1050
QQRQQQQQQQ QQQEYQELFR HMNQGDAGSL APSLGGQSMT ERQALSYQNA
1060 1070 1080 1090 1100
DSYHHHTSPQ HLLQIRAQEC VSQASSPTPP HGYAHQPALM HSESMEEDCS
1110 1120 1130 1140 1150
CEGAKDGFQD SKSSSTLTKG CHDSPLLLST GGPGDPESLL GTVSHAQELG
1160 1170 1180 1190 1200
IHPYGHQPTA AFSKNKVPSR EPVIGNCMDR SSPGQAVELP DHNGLGYPAR
1210 1220 1230 1240 1250
PSVHEHHRPR ALQRHHTIQN SDDAYVQLDN LPGMSLVAGK ALSSARMSDA
1260 1270 1280 1290 1300
VLSQSSLMGS QQFQDGENEE CGASLGGHEH PDLSDGSQHL NSSCYPSTCI
1310 1320
TDILLSYKHP EVSFSMEQAG V
Length:1,321
Mass (Da):144,851
Last modified:March 28, 2018 - v4
Checksum:i84FA57F6BB5505DA
GO
Isoform 2 (identifier: Q9Y2K2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-760: MAAAAASGAG...PMSSAMIQPH → MACSTPHGSN...SQPSLPISSR
     874-933: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:641
Mass (Da):69,736
Checksum:iA07CFF76C242F373
GO
Isoform 3 (identifier: Q9Y2K2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1171-1187: EPVIGNCMDRSSPGQAV → GKCLLTVEVLGQSALIN
     1188-1321: Missing.

Note: No experimental confirmation available.
Show »
Length:1,187
Mass (Da):130,347
Checksum:i3158F58032EC7E9B
GO
Isoform 4 (identifier: Q9Y2K2-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     365-412: Missing.
     603-603: S → RYLANRSKRHTLAMTNPTAEIPPDLQRQLGQQPFRSRVWPPHLVPDQHR
     874-933: Missing.

Note: No experimental confirmation available.
Show »
Length:1,261
Mass (Da):138,586
Checksum:i36FE1ABFEB26690E
GO

Sequence cautioni

The sequence AAH63887 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI28511 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA76843 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB14006 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035634389H → L in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_0516621098D → E. Corresponds to variant dbSNP:rs11216163Ensembl.1
Natural variantiVAR_0516631136P → R1 PublicationCorresponds to variant dbSNP:rs12225230Ensembl.1
Natural variantiVAR_0356351161A → V in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0594121 – 760MAAAA…MIQPH → MACSTPHGSNRRLPRKCHFS LPTRTPTLCTSLRSVSPLCA GSQMGLRASRPSKLTWKKWA TTAASNSCSRSVSSCRRCTG GRLMKEPWRRPSSSICYTSR SSTIKFSSNKFKTLSVLLSH LHLFRLHVKISQPSLPISSR in isoform 2. Add BLAST760
Alternative sequenceiVSP_059413365 – 412Missing in isoform 4. Add BLAST48
Alternative sequenceiVSP_059414603S → RYLANRSKRHTLAMTNPTAE IPPDLQRQLGQQPFRSRVWP PHLVPDQHR in isoform 4. 1
Alternative sequenceiVSP_059415874 – 933Missing in isoform 2 and isoform 4. Add BLAST60
Alternative sequenceiVSP_0594161171 – 1187EPVIG…PGQAV → GKCLLTVEVLGQSALIN in isoform 3. Add BLAST17
Alternative sequenceiVSP_0594171188 – 1321Missing in isoform 3. Add BLAST134

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023216 mRNA. Translation: BAA76843.2. Different initiation.
AP000936 Genomic DNA. No translation available.
AP003070 Genomic DNA. No translation available.
AP006216 Genomic DNA. No translation available.
BC035583 mRNA. Translation: AAH35583.3.
BC063887 mRNA. Translation: AAH63887.1. Different initiation.
BC086858 mRNA. Translation: AAH86858.1.
BC128510 mRNA. Translation: AAI28511.1. Different initiation.
AB209327 mRNA. Translation: BAD92564.1.
AK022302 mRNA. Translation: BAB14006.1. Different initiation.
AY598338 mRNA. Translation: AAT06749.1.
RefSeqiNP_001268678.1. NM_001281749.1.
NP_079440.3. NM_025164.4.
UniGeneiHs.167451.

Genome annotation databases

EnsembliENST00000292055; ENSP00000292055; ENSG00000160584.
ENST00000375288; ENSP00000364437; ENSG00000160584.
ENST00000542607; ENSP00000438108; ENSG00000160584.
GeneIDi23387.
KEGGihsa:23387.
UCSCiuc001ppy.5. human.
uc001pqa.5. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSIK3_HUMAN
AccessioniPrimary (citable) accession number: Q9Y2K2
Secondary accession number(s): A1A5A8
, H0Y494, J3KPC8, Q59FY2, Q5M9N1, Q6P3R6, Q8IYM8, Q9HA50
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: March 28, 2018
Last modified: March 28, 2018
This is version 144 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome