Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Angiomotin-like protein 2

Gene

AMOTL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulates the translocation of phosphorylated SRC to peripheral cell-matrix adhesion sites. Required for proper architecture of actin filaments. Inhibits the Wnt/beta-catenin signaling pathway, probably by recruiting CTNNB1 to recycling endosomes and hence preventing its translocation to the nucleus. Participates in angiogenesis. May play a role in the polarity, proliferation and migration of endothelial cells. Selectively promotes FGF-induced MAPK activation through SRC.3 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processWnt signaling pathway

Enzyme and pathway databases

ReactomeiR-HSA-2028269. Signaling by Hippo.

Names & Taxonomyi

Protein namesi
Recommended name:
Angiomotin-like protein 2
Alternative name(s):
Leman coiled-coil protein
Short name:
LCCP
Gene namesi
Name:AMOTL2
Synonyms:KIAA0989
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:17812. AMOTL2.

Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

Endosome

Pathology & Biotechi

Organism-specific databases

DisGeNETi51421.
OpenTargetsiENSG00000114019.
PharmGKBiPA24775.

Polymorphism and mutation databases

BioMutaiAMOTL2.
DMDMi308153633.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001906721 – 779Angiomotin-like protein 2Add BLAST779

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei107Phosphotyrosine; by FGFR1By similarity1
Modified residuei759PhosphoserineCombined sources1
Modified residuei762PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylation at Tyr-107 is necessary for efficient binding to SRC and synergistically functioning with SRC to activate the downstream MAPK pathway.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9Y2J4.
PaxDbiQ9Y2J4.
PeptideAtlasiQ9Y2J4.
PRIDEiQ9Y2J4.

PTM databases

iPTMnetiQ9Y2J4.
PhosphoSitePlusiQ9Y2J4.

Expressioni

Gene expression databases

BgeeiENSG00000114019.
CleanExiHS_AMOTL2.
ExpressionAtlasiQ9Y2J4. baseline and differential.
GenevisibleiQ9Y2J4. HS.

Organism-specific databases

HPAiHPA063027.

Interactioni

Subunit structurei

Interacts with SRC.1 Publication

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119530. 79 interactors.
DIPiDIP-57510N.
IntActiQ9Y2J4. 108 interactors.
STRINGi9606.ENSP00000249883.

Structurei

3D structure databases

ProteinModelPortaliQ9Y2J4.
SMRiQ9Y2J4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili308 – 581Sequence analysisAdd BLAST274

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi776 – 779PDZ-binding4

Sequence similaritiesi

Belongs to the angiomotin family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IEF3. Eukaryota.
ENOG410ZEXZ. LUCA.
GeneTreeiENSGT00530000063846.
HOGENOMiHOG000233789.
HOVERGENiHBG066485.
InParanoidiQ9Y2J4.
KOiK06104.
OMAiEHQGGET.
OrthoDBiEOG091G07Y9.
PhylomeDBiQ9Y2J4.
TreeFamiTF333368.

Family and domain databases

InterProiView protein in InterPro
IPR009114. Angiomotin.
IPR024646. Angiomotin_C.
PfamiView protein in Pfam
PF12240. Angiomotin_C. 1 hit.
PRINTSiPR01807. ANGIOMOTIN.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y2J4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRTLEDSSGT VLHRLIQEQL RYGNLTETRT LLAIQQQALR GGAGTGGTGS
60 70 80 90 100
PQASLEILAP EDSQVLQQAT RQEPQGQEHQ GGENHLAENT LYRLCPQPSK
110 120 130 140 150
GEELPTYEEA KAHSQYYAAQ QAGTRPHAGD RDPRGAPGGS RRQDEALREL
160 170 180 190 200
RHGHVRSLSE RLLQLSLERN GARAPSHMSS SHSFPQLARN QQGPPLRGPP
210 220 230 240 250
AEGPESRGPP PQYPHVVLAH ETTTAVTDPR YRARGSPHFQ HAEVRILQAQ
260 270 280 290 300
VPPVFLQQQQ QYQYLQQSQE HPPPPHPAAL GHGPLSSLSP PAVEGPVSAQ
310 320 330 340 350
ASSATSGSAH LAQMEAVLRE NARLQRDNER LQRELESSAE KAGRIEKLES
360 370 380 390 400
EIQRLSEAHE SLTRASSKRE ALEKTMRNKM DSEMRRLQDF NRDLRERLES
410 420 430 440 450
ANRRLASKTQ EAQAGSQDMV AKLLAQSYEQ QQEQEKLERE MALLRGAIED
460 470 480 490 500
QRRRAELLEQ ALGNAQGRAA RAEEELRKKQ AYVEKVERLQ QALGQLQAAC
510 520 530 540 550
EKREQLELRL RTRLEQELKA LRAQQRQAGA PGGSSGSGGS PELSALRLSE
560 570 580 590 600
QLREKEEQIL ALEADMTKWE QKYLEERAMR QFAMDAAATA AAQRDTTLIR
610 620 630 640 650
HSPQPSPSSS FNEGLLTGGH RHQEMESRLK VLHAQILEKD AVIKVLQQRS
660 670 680 690 700
RRDPGKAIQG SLRPAKSVPS VFAAAAAGTQ GWQGLSSSER QTADAPARLT
710 720 730 740 750
TDRAPTEEPV VTAPPAAHAK HGSRDGSTQT EGPPDSTSTC LPPEPDSLLG
760 770
CSSSQRAASL DSVATSRVQD LSDMVEILI
Length:779
Mass (Da):85,764
Last modified:October 5, 2010 - v3
Checksum:i665BE69FD7757CEF
GO
Isoform 2 (identifier: Q9Y2J4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     701-701: T → TA

Show »
Length:780
Mass (Da):85,835
Checksum:iBC8B569E10247B01
GO
Isoform 3 (identifier: Q9Y2J4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     525-526: Missing.

Note: No experimental confirmation available.
Show »
Length:777
Mass (Da):85,480
Checksum:i0B454D787F017544
GO
Isoform 4 (identifier: Q9Y2J4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTGRKASGGTPCTLRKGAPIITLGKNWTERLAAGDSVGCSGARCHRPLSRQLCASQRSM

Note: No experimental confirmation available.
Show »
Length:837
Mass (Da):91,817
Checksum:i18CC1B88CF34F90A
GO

Sequence cautioni

The sequence AAH11454 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA76833 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAD97318 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti666K → E in BAH12987 (PubMed:14702039).Curated1
Sequence conflicti680Q → K in AAD56361 (PubMed:12406577).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_055497227T → I. Corresponds to variant dbSNP:rs35377537Ensembl.1
Natural variantiVAR_055498342A → P. Corresponds to variant dbSNP:rs2303635Ensembl.1
Natural variantiVAR_055499415G → S. Corresponds to variant dbSNP:rs2241559Ensembl.1
Natural variantiVAR_023535731E → D4 PublicationsCorresponds to variant dbSNP:rs1353776Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0440811M → MTGRKASGGTPCTLRKGAPI ITLGKNWTERLAAGDSVGCS GARCHRPLSRQLCASQRSM in isoform 4. 1 Publication1
Alternative sequenceiVSP_037826525 – 526Missing in isoform 3. 1 Publication2
Alternative sequenceiVSP_015711701T → TA in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023206 mRNA. Translation: BAA76833.1. Different initiation.
AK291616 mRNA. Translation: BAF84305.1.
AK299270 mRNA. Translation: BAH12987.1.
AK223598 mRNA. Translation: BAD97318.1. Different initiation.
AF175966 mRNA. Translation: AAD56361.2.
AC010207 Genomic DNA. No translation available.
BC011454 mRNA. Translation: AAH11454.1. Different initiation.
CCDSiCCDS33860.1. [Q9Y2J4-2]
CCDS63783.1. [Q9Y2J4-3]
CCDS63784.1. [Q9Y2J4-4]
RefSeqiNP_001265612.1. NM_001278683.1. [Q9Y2J4-4]
NP_001265614.1. NM_001278685.1. [Q9Y2J4-3]
NP_057285.3. NM_016201.3. [Q9Y2J4-2]
XP_006713717.1. XM_006713654.2. [Q9Y2J4-1]
XP_011511183.1. XM_011512881.1. [Q9Y2J4-1]
XP_016862069.1. XM_017006580.1. [Q9Y2J4-2]
XP_016862070.1. XM_017006581.1. [Q9Y2J4-2]
XP_016862071.1. XM_017006582.1. [Q9Y2J4-2]
UniGeneiHs.426312.
Hs.713601.

Genome annotation databases

EnsembliENST00000249883; ENSP00000249883; ENSG00000114019. [Q9Y2J4-2]
ENST00000422605; ENSP00000409999; ENSG00000114019. [Q9Y2J4-1]
ENST00000513145; ENSP00000425475; ENSG00000114019. [Q9Y2J4-3]
ENST00000514516; ENSP00000424765; ENSG00000114019. [Q9Y2J4-4]
GeneIDi51421.
KEGGihsa:51421.
UCSCiuc003eqf.4. human. [Q9Y2J4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023206 mRNA. Translation: BAA76833.1. Different initiation.
AK291616 mRNA. Translation: BAF84305.1.
AK299270 mRNA. Translation: BAH12987.1.
AK223598 mRNA. Translation: BAD97318.1. Different initiation.
AF175966 mRNA. Translation: AAD56361.2.
AC010207 Genomic DNA. No translation available.
BC011454 mRNA. Translation: AAH11454.1. Different initiation.
CCDSiCCDS33860.1. [Q9Y2J4-2]
CCDS63783.1. [Q9Y2J4-3]
CCDS63784.1. [Q9Y2J4-4]
RefSeqiNP_001265612.1. NM_001278683.1. [Q9Y2J4-4]
NP_001265614.1. NM_001278685.1. [Q9Y2J4-3]
NP_057285.3. NM_016201.3. [Q9Y2J4-2]
XP_006713717.1. XM_006713654.2. [Q9Y2J4-1]
XP_011511183.1. XM_011512881.1. [Q9Y2J4-1]
XP_016862069.1. XM_017006580.1. [Q9Y2J4-2]
XP_016862070.1. XM_017006581.1. [Q9Y2J4-2]
XP_016862071.1. XM_017006582.1. [Q9Y2J4-2]
UniGeneiHs.426312.
Hs.713601.

3D structure databases

ProteinModelPortaliQ9Y2J4.
SMRiQ9Y2J4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119530. 79 interactors.
DIPiDIP-57510N.
IntActiQ9Y2J4. 108 interactors.
STRINGi9606.ENSP00000249883.

PTM databases

iPTMnetiQ9Y2J4.
PhosphoSitePlusiQ9Y2J4.

Polymorphism and mutation databases

BioMutaiAMOTL2.
DMDMi308153633.

Proteomic databases

EPDiQ9Y2J4.
PaxDbiQ9Y2J4.
PeptideAtlasiQ9Y2J4.
PRIDEiQ9Y2J4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000249883; ENSP00000249883; ENSG00000114019. [Q9Y2J4-2]
ENST00000422605; ENSP00000409999; ENSG00000114019. [Q9Y2J4-1]
ENST00000513145; ENSP00000425475; ENSG00000114019. [Q9Y2J4-3]
ENST00000514516; ENSP00000424765; ENSG00000114019. [Q9Y2J4-4]
GeneIDi51421.
KEGGihsa:51421.
UCSCiuc003eqf.4. human. [Q9Y2J4-1]

Organism-specific databases

CTDi51421.
DisGeNETi51421.
GeneCardsiAMOTL2.
HGNCiHGNC:17812. AMOTL2.
HPAiHPA063027.
MIMi614658. gene.
neXtProtiNX_Q9Y2J4.
OpenTargetsiENSG00000114019.
PharmGKBiPA24775.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEF3. Eukaryota.
ENOG410ZEXZ. LUCA.
GeneTreeiENSGT00530000063846.
HOGENOMiHOG000233789.
HOVERGENiHBG066485.
InParanoidiQ9Y2J4.
KOiK06104.
OMAiEHQGGET.
OrthoDBiEOG091G07Y9.
PhylomeDBiQ9Y2J4.
TreeFamiTF333368.

Enzyme and pathway databases

ReactomeiR-HSA-2028269. Signaling by Hippo.

Miscellaneous databases

ChiTaRSiAMOTL2. human.
GeneWikiiAMOTL2.
GenomeRNAii51421.
PROiPR:Q9Y2J4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000114019.
CleanExiHS_AMOTL2.
ExpressionAtlasiQ9Y2J4. baseline and differential.
GenevisibleiQ9Y2J4. HS.

Family and domain databases

InterProiView protein in InterPro
IPR009114. Angiomotin.
IPR024646. Angiomotin_C.
PfamiView protein in Pfam
PF12240. Angiomotin_C. 1 hit.
PRINTSiPR01807. ANGIOMOTIN.
ProtoNetiSearch...

Entry informationi

Entry nameiAMOL2_HUMAN
AccessioniPrimary (citable) accession number: Q9Y2J4
Secondary accession number(s): A8K6F1
, B7Z5Q1, E9PHW3, Q53EP1, Q96F99, Q9UKB4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 27, 2005
Last sequence update: October 5, 2010
Last modified: May 10, 2017
This is version 129 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.