Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y2H0

- DLGP4_HUMAN

UniProt

Q9Y2H0 - DLGP4_HUMAN

Protein

Disks large-associated protein 4

Gene

DLGAP4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 116 (01 Oct 2014)
      Sequence version 3 (22 Jul 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in the molecular organization of synapses and neuronal cell signaling. Could be an adapter protein linking ion channel to the subsynaptic cytoskeleton. May induce enrichment of PSD-95/SAP90 at the plasma membrane.

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. cell-cell signaling Source: InterPro

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Disks large-associated protein 4
    Short name:
    DAP-4
    Alternative name(s):
    PSD-95/SAP90-binding protein 4
    SAP90/PSD-95-associated protein 4
    Short name:
    SAPAP-4
    Gene namesi
    Name:DLGAP4
    Synonyms:DAP4, KIAA0964, SAPAP4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 20

    Organism-specific databases

    HGNCiHGNC:24476. DLGAP4.

    Subcellular locationi

    Membrane By similarity; Peripheral membrane protein By similarity

    GO - Cellular componenti

    1. membrane Source: UniProtKB-SubCell
    2. synapse Source: Ensembl

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134891458.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 992992Disks large-associated protein 4PRO_0000174297Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei378 – 3781PhosphoserineBy similarity
    Modified residuei915 – 9151Phosphothreonine3 Publications
    Modified residuei973 – 9731Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9Y2H0.
    PaxDbiQ9Y2H0.
    PRIDEiQ9Y2H0.

    PTM databases

    PhosphoSiteiQ9Y2H0.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9Y2H0.
    BgeeiQ9Y2H0.
    CleanExiHS_DLGAP4.
    GenevestigatoriQ9Y2H0.

    Organism-specific databases

    HPAiHPA054105.
    HPA056378.

    Interactioni

    Subunit structurei

    Interacts with DLG1 and DLG4/PSD-95.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    BIN1O004994EBI-722139,EBI-719094
    GRB2P629932EBI-722139,EBI-401755
    NCK1P163335EBI-722139,EBI-389883
    PIK3R1P279862EBI-722139,EBI-79464

    Protein-protein interaction databases

    BioGridi116513. 8 interactions.
    IntActiQ9Y2H0. 14 interactions.
    MINTiMINT-8105041.
    STRINGi9606.ENSP00000363023.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Y2H0.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi267 – 2748Poly-Pro

    Sequence similaritiesi

    Belongs to the SAPAP family.Curated

    Phylogenomic databases

    eggNOGiNOG331770.
    HOVERGENiHBG018957.
    InParanoidiQ9Y2H0.
    OMAiKNNTAEL.
    PhylomeDBiQ9Y2H0.
    TreeFamiTF321382.

    Family and domain databases

    InterProiIPR005026. GKAP.
    [Graphical view]
    PfamiPF03359. GKAP. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9Y2H0-2) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKGLGDSRPR HLSDSLDPPH EPLFAGTDRN PYLLSPTEAF AREARFPGQN    50
    TLPGDGLFPL NNQLPPPSST FPRIHYNSHF EVPEESPFPS HAQATKINRL 100
    PANLLDQFEK QLPIHRDGFS TLQFPRGEAK ARGESPGRIR HLVHSVQRLF 150
    FTKAPSLEGT AGKVGGNGSK KGGMEDGKGR RAKSKERAKA GEPKRRSRSN 200
    ISGWWSSDDN LDGEAGAFRS SGPASGLMTL GRQAERSQPR YFMHAYNTIS 250
    GHMLKTTKNN TTELTAPPPP PAPPATCPSL GVGTDTNYVK RGSWSTLTLS 300
    HAHEVCQKTS ATLDKSLLKS KSCHQGLAYH YLQVPGGGGE WSTTLLSPRE 350
    TDAAAEGPIP CRRMRSGSYI KAMGDEDSDE SGGSPKPSPK TAARRQSYLR 400
    ATQQSLGEQS NPRRSLDRLD SVDMLLPSKC PSWEEDYTPV SDSLNDSSCI 450
    SQIFGQASLI PQLFGHEQQV REAELSDQYE AACESACSEA ESTAAETLDL 500
    PLPSYFRSRS HSYLRAIQAG CSQEEDSVSL QSLSPPPSTG SLSNSRTLPS 550
    SSCLVAYKKT PPPVPPRTTS KPFISVTVQS STESAQDTYL DSQDHKSEVT 600
    SQSGLSNSSD SLDSSTRPPS VTRGGVAPAP EAPEPPPKHA ALKSEQGTLT 650
    SSESHPEAAP KRKLSSIGIQ VDCIQPVPKE EPSPATKFQS IGVQVEDDWR 700
    SSVPSHSMSS RRDTDSDTQD ANDSSCKSSE RSLPDCTPHP NSISIDAGPR 750
    QAPKIAQIKR NLSYGDNSDP ALEASSLPPP DPWLETSSSS PAEPAQPGAC 800
    RRDGYWFLKL LQAETERLEG WCCQMDKETK ENNLSEEVLG KVLSAVGSAQ 850
    LLMSQKFQQF RGLCEQNLNP DANPRPTAQD LAGFWDLLQL SIEDISMKFD 900
    ELYHLKANSW QLVETPEKRK EEKKPPPPVP KKPAKSKPAV SRDKASDASD 950
    KQRQEARKRL LAAKRAASVR QNSATESADS IEIYVPEAQT RL 992
    Length:992
    Mass (Da):108,012
    Last modified:July 22, 2008 - v3
    Checksum:iF0EBFBE0DE1AC814
    GO
    Isoform 2 (identifier: Q9Y2H0-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         671-700: VDCIQPVPKEEPSPATKFQSIGVQVEDDWR → ERTRRNGSHLSEDNGPKAIDVMAPSSE

    Show »
    Length:989
    Mass (Da):107,567
    Checksum:iB2FD9A2103E052EB
    GO
    Isoform 3 (identifier: Q9Y2H0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-539: Missing.
         540-550: GSLSNSRTLPS → MALCLELLKQC

    Show »
    Length:453
    Mass (Da):49,478
    Checksum:i877C20CA747800EB
    GO

    Sequence cautioni

    The sequence BAA76808.2 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti229 – 2291T → I in BAA76808. (PubMed:10231032)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti486 – 4861A → T.
    Corresponds to variant rs6019652 [ dbSNP | Ensembl ].
    VAR_057716
    Natural varianti861 – 8611R → Q.
    Corresponds to variant rs2275807 [ dbSNP | Ensembl ].
    VAR_057717

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 539539Missing in isoform 3. 1 PublicationVSP_034910Add
    BLAST
    Alternative sequencei540 – 55011GSLSNSRTLPS → MALCLELLKQC in isoform 3. 1 PublicationVSP_034911Add
    BLAST
    Alternative sequencei671 – 70030VDCIQ…EDDWR → ERTRRNGSHLSEDNGPKAID VMAPSSE in isoform 2. 1 PublicationVSP_006013Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB023181 mRNA. Translation: BAA76808.2. Different initiation.
    AL390374, AL050318 Genomic DNA. Translation: CAI17927.1.
    AL390374, AL050318 Genomic DNA. Translation: CAI17928.1.
    AL050318, AL390374 Genomic DNA. Translation: CAI23506.1.
    AL050318, AL390374 Genomic DNA. Translation: CAI23507.1.
    AL390374, AL050318 Genomic DNA. Translation: CAI17929.1.
    AL050318, AL390374 Genomic DNA. Translation: CAI23509.1.
    CH471077 Genomic DNA. Translation: EAW76140.1.
    CH471077 Genomic DNA. Translation: EAW76135.1.
    CH471077 Genomic DNA. Translation: EAW76136.1.
    BC108706 mRNA. Translation: AAI08707.1.
    BC153874 mRNA. Translation: AAI53875.1.
    CCDSiCCDS13274.1. [Q9Y2H0-1]
    CCDS13275.1. [Q9Y2H0-3]
    RefSeqiNP_001035951.1. NM_001042486.3.
    NP_055717.2. NM_014902.5. [Q9Y2H0-1]
    NP_892118.1. NM_183006.3. [Q9Y2H0-3]
    XP_005260386.1. XM_005260329.2. [Q9Y2H0-2]
    UniGeneiHs.249600.

    Genome annotation databases

    EnsembliENST00000339266; ENSP00000341633; ENSG00000080845. [Q9Y2H0-2]
    ENST00000340491; ENSP00000345700; ENSG00000080845. [Q9Y2H0-3]
    ENST00000373907; ENSP00000363014; ENSG00000080845. [Q9Y2H0-2]
    ENST00000373913; ENSP00000363023; ENSG00000080845. [Q9Y2H0-1]
    ENST00000401952; ENSP00000384954; ENSG00000080845. [Q9Y2H0-1]
    GeneIDi22839.
    KEGGihsa:22839.
    UCSCiuc002xff.3. human. [Q9Y2H0-1]
    uc002xfg.3. human. [Q9Y2H0-3]

    Polymorphism databases

    DMDMi205831580.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB023181 mRNA. Translation: BAA76808.2 . Different initiation.
    AL390374 , AL050318 Genomic DNA. Translation: CAI17927.1 .
    AL390374 , AL050318 Genomic DNA. Translation: CAI17928.1 .
    AL050318 , AL390374 Genomic DNA. Translation: CAI23506.1 .
    AL050318 , AL390374 Genomic DNA. Translation: CAI23507.1 .
    AL390374 , AL050318 Genomic DNA. Translation: CAI17929.1 .
    AL050318 , AL390374 Genomic DNA. Translation: CAI23509.1 .
    CH471077 Genomic DNA. Translation: EAW76140.1 .
    CH471077 Genomic DNA. Translation: EAW76135.1 .
    CH471077 Genomic DNA. Translation: EAW76136.1 .
    BC108706 mRNA. Translation: AAI08707.1 .
    BC153874 mRNA. Translation: AAI53875.1 .
    CCDSi CCDS13274.1. [Q9Y2H0-1 ]
    CCDS13275.1. [Q9Y2H0-3 ]
    RefSeqi NP_001035951.1. NM_001042486.3.
    NP_055717.2. NM_014902.5. [Q9Y2H0-1 ]
    NP_892118.1. NM_183006.3. [Q9Y2H0-3 ]
    XP_005260386.1. XM_005260329.2. [Q9Y2H0-2 ]
    UniGenei Hs.249600.

    3D structure databases

    ProteinModelPortali Q9Y2H0.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116513. 8 interactions.
    IntActi Q9Y2H0. 14 interactions.
    MINTi MINT-8105041.
    STRINGi 9606.ENSP00000363023.

    PTM databases

    PhosphoSitei Q9Y2H0.

    Polymorphism databases

    DMDMi 205831580.

    Proteomic databases

    MaxQBi Q9Y2H0.
    PaxDbi Q9Y2H0.
    PRIDEi Q9Y2H0.

    Protocols and materials databases

    DNASUi 22839.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000339266 ; ENSP00000341633 ; ENSG00000080845 . [Q9Y2H0-2 ]
    ENST00000340491 ; ENSP00000345700 ; ENSG00000080845 . [Q9Y2H0-3 ]
    ENST00000373907 ; ENSP00000363014 ; ENSG00000080845 . [Q9Y2H0-2 ]
    ENST00000373913 ; ENSP00000363023 ; ENSG00000080845 . [Q9Y2H0-1 ]
    ENST00000401952 ; ENSP00000384954 ; ENSG00000080845 . [Q9Y2H0-1 ]
    GeneIDi 22839.
    KEGGi hsa:22839.
    UCSCi uc002xff.3. human. [Q9Y2H0-1 ]
    uc002xfg.3. human. [Q9Y2H0-3 ]

    Organism-specific databases

    CTDi 22839.
    GeneCardsi GC20P034894.
    HGNCi HGNC:24476. DLGAP4.
    HPAi HPA054105.
    HPA056378.
    neXtProti NX_Q9Y2H0.
    PharmGKBi PA134891458.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG331770.
    HOVERGENi HBG018957.
    InParanoidi Q9Y2H0.
    OMAi KNNTAEL.
    PhylomeDBi Q9Y2H0.
    TreeFami TF321382.

    Miscellaneous databases

    ChiTaRSi DLGAP4. human.
    GeneWikii DLGAP4.
    GenomeRNAii 22839.
    NextBioi 43281.
    PROi Q9Y2H0.

    Gene expression databases

    ArrayExpressi Q9Y2H0.
    Bgeei Q9Y2H0.
    CleanExi HS_DLGAP4.
    Genevestigatori Q9Y2H0.

    Family and domain databases

    InterProi IPR005026. GKAP.
    [Graphical view ]
    Pfami PF03359. GKAP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 6:63-70(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    2. "The DNA sequence and comparative analysis of human chromosome 20."
      Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
      , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
      Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: PNS.
    5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915 AND SER-973, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiDLGP4_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y2H0
    Secondary accession number(s): E1P5T5
    , Q5QPG4, Q5T2Y4, Q5T2Y5, Q9H137, Q9H138, Q9H1L7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 26, 2001
    Last sequence update: July 22, 2008
    Last modified: October 1, 2014
    This is version 116 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 20
      Human chromosome 20: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3