Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Y2H0 (DLGP4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 112. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Disks large-associated protein 4

Short name=DAP-4
Alternative name(s):
PSD-95/SAP90-binding protein 4
SAP90/PSD-95-associated protein 4
Short name=SAPAP-4
Gene names
Name:DLGAP4
Synonyms:DAP4, KIAA0964, SAPAP4
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length992 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play a role in the molecular organization of synapses and neuronal cell signaling. Could be an adapter protein linking ion channel to the subsynaptic cytoskeleton. May induce enrichment of PSD-95/SAP90 at the plasma membrane.

Subunit structure

Interacts with DLG1 and DLG4/PSD-95 By similarity.

Subcellular location

Membrane; Peripheral membrane protein By similarity.

Sequence similarities

Belongs to the SAPAP family.

Sequence caution

The sequence BAA76808.2 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
Polymorphism
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell-cell signaling

Inferred from electronic annotation. Source: InterPro

   Cellular_componentmembrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

synapse

Inferred from electronic annotation. Source: Ensembl

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9Y2H0-2)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9Y2H0-1)

The sequence of this isoform differs from the canonical sequence as follows:
     671-700: VDCIQPVPKEEPSPATKFQSIGVQVEDDWR → ERTRRNGSHLSEDNGPKAIDVMAPSSE
Isoform 3 (identifier: Q9Y2H0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-539: Missing.
     540-550: GSLSNSRTLPS → MALCLELLKQC

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 992992Disks large-associated protein 4
PRO_0000174297

Regions

Compositional bias267 – 2748Poly-Pro

Amino acid modifications

Modified residue3781Phosphoserine By similarity
Modified residue9151Phosphothreonine Ref.5 Ref.7 Ref.8
Modified residue9731Phosphoserine Ref.8

Natural variations

Alternative sequence1 – 539539Missing in isoform 3.
VSP_034910
Alternative sequence540 – 55011GSLSNSRTLPS → MALCLELLKQC in isoform 3.
VSP_034911
Alternative sequence671 – 70030VDCIQ…EDDWR → ERTRRNGSHLSEDNGPKAID VMAPSSE in isoform 2.
VSP_006013
Natural variant4861A → T.
Corresponds to variant rs6019652 [ dbSNP | Ensembl ].
VAR_057716
Natural variant8611R → Q.
Corresponds to variant rs2275807 [ dbSNP | Ensembl ].
VAR_057717

Experimental info

Sequence conflict2291T → I in BAA76808. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 22, 2008. Version 3.
Checksum: F0EBFBE0DE1AC814

FASTA992108,012
        10         20         30         40         50         60 
MKGLGDSRPR HLSDSLDPPH EPLFAGTDRN PYLLSPTEAF AREARFPGQN TLPGDGLFPL 

        70         80         90        100        110        120 
NNQLPPPSST FPRIHYNSHF EVPEESPFPS HAQATKINRL PANLLDQFEK QLPIHRDGFS 

       130        140        150        160        170        180 
TLQFPRGEAK ARGESPGRIR HLVHSVQRLF FTKAPSLEGT AGKVGGNGSK KGGMEDGKGR 

       190        200        210        220        230        240 
RAKSKERAKA GEPKRRSRSN ISGWWSSDDN LDGEAGAFRS SGPASGLMTL GRQAERSQPR 

       250        260        270        280        290        300 
YFMHAYNTIS GHMLKTTKNN TTELTAPPPP PAPPATCPSL GVGTDTNYVK RGSWSTLTLS 

       310        320        330        340        350        360 
HAHEVCQKTS ATLDKSLLKS KSCHQGLAYH YLQVPGGGGE WSTTLLSPRE TDAAAEGPIP 

       370        380        390        400        410        420 
CRRMRSGSYI KAMGDEDSDE SGGSPKPSPK TAARRQSYLR ATQQSLGEQS NPRRSLDRLD 

       430        440        450        460        470        480 
SVDMLLPSKC PSWEEDYTPV SDSLNDSSCI SQIFGQASLI PQLFGHEQQV REAELSDQYE 

       490        500        510        520        530        540 
AACESACSEA ESTAAETLDL PLPSYFRSRS HSYLRAIQAG CSQEEDSVSL QSLSPPPSTG 

       550        560        570        580        590        600 
SLSNSRTLPS SSCLVAYKKT PPPVPPRTTS KPFISVTVQS STESAQDTYL DSQDHKSEVT 

       610        620        630        640        650        660 
SQSGLSNSSD SLDSSTRPPS VTRGGVAPAP EAPEPPPKHA ALKSEQGTLT SSESHPEAAP 

       670        680        690        700        710        720 
KRKLSSIGIQ VDCIQPVPKE EPSPATKFQS IGVQVEDDWR SSVPSHSMSS RRDTDSDTQD 

       730        740        750        760        770        780 
ANDSSCKSSE RSLPDCTPHP NSISIDAGPR QAPKIAQIKR NLSYGDNSDP ALEASSLPPP 

       790        800        810        820        830        840 
DPWLETSSSS PAEPAQPGAC RRDGYWFLKL LQAETERLEG WCCQMDKETK ENNLSEEVLG 

       850        860        870        880        890        900 
KVLSAVGSAQ LLMSQKFQQF RGLCEQNLNP DANPRPTAQD LAGFWDLLQL SIEDISMKFD 

       910        920        930        940        950        960 
ELYHLKANSW QLVETPEKRK EEKKPPPPVP KKPAKSKPAV SRDKASDASD KQRQEARKRL 

       970        980        990 
LAAKRAASVR QNSATESADS IEIYVPEAQT RL 

« Hide

Isoform 2 [UniParc].

Checksum: B2FD9A2103E052EB
Show »

FASTA989107,567
Isoform 3 [UniParc].

Checksum: 877C20CA747800EB
Show »

FASTA45349,478

References

[1]"Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 6:63-70(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[2]"The DNA sequence and comparative analysis of human chromosome 20."
Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. expand/collapse author list , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: PNS.
[5]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[6]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[7]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915 AND SER-973, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB023181 mRNA. Translation: BAA76808.2. Different initiation.
AL390374, AL050318 Genomic DNA. Translation: CAI17927.1.
AL390374, AL050318 Genomic DNA. Translation: CAI17928.1.
AL050318, AL390374 Genomic DNA. Translation: CAI23506.1.
AL050318, AL390374 Genomic DNA. Translation: CAI23507.1.
AL390374, AL050318 Genomic DNA. Translation: CAI17929.1.
AL050318, AL390374 Genomic DNA. Translation: CAI23509.1.
CH471077 Genomic DNA. Translation: EAW76140.1.
CH471077 Genomic DNA. Translation: EAW76135.1.
CH471077 Genomic DNA. Translation: EAW76136.1.
BC108706 mRNA. Translation: AAI08707.1.
BC153874 mRNA. Translation: AAI53875.1.
RefSeqNP_001035951.1. NM_001042486.2.
NP_055717.2. NM_014902.4.
NP_892118.1. NM_183006.2.
XP_005260386.1. XM_005260329.2.
UniGeneHs.249600.

3D structure databases

ProteinModelPortalQ9Y2H0.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid116513. 8 interactions.
IntActQ9Y2H0. 14 interactions.
MINTMINT-8105041.
STRING9606.ENSP00000363023.

PTM databases

PhosphoSiteQ9Y2H0.

Polymorphism databases

DMDM205831580.

Proteomic databases

PaxDbQ9Y2H0.
PRIDEQ9Y2H0.

Protocols and materials databases

DNASU22839.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000339266; ENSP00000341633; ENSG00000080845. [Q9Y2H0-2]
ENST00000340491; ENSP00000345700; ENSG00000080845. [Q9Y2H0-3]
ENST00000373907; ENSP00000363014; ENSG00000080845. [Q9Y2H0-2]
ENST00000373913; ENSP00000363023; ENSG00000080845. [Q9Y2H0-1]
ENST00000401952; ENSP00000384954; ENSG00000080845. [Q9Y2H0-1]
ENST00000594949; ENSP00000470606; ENSG00000269562. [Q9Y2H0-1]
ENST00000595745; ENSP00000469319; ENSG00000269562. [Q9Y2H0-2]
ENST00000596880; ENSP00000471074; ENSG00000269562. [Q9Y2H0-3]
ENST00000597268; ENSP00000472269; ENSG00000269562. [Q9Y2H0-1]
ENST00000598628; ENSP00000469167; ENSG00000269562. [Q9Y2H0-2]
GeneID22839.
KEGGhsa:22839.
UCSCuc002xff.3. human. [Q9Y2H0-1]
uc002xfg.3. human. [Q9Y2H0-3]

Organism-specific databases

CTD22839.
GeneCardsGC20P034894.
HGNCHGNC:24476. DLGAP4.
HPAHPA054105.
HPA056378.
neXtProtNX_Q9Y2H0.
PharmGKBPA134891458.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG331770.
HOVERGENHBG018957.
InParanoidQ9Y2H0.
OMAQDRRSEV.
PhylomeDBQ9Y2H0.
TreeFamTF321382.

Gene expression databases

ArrayExpressQ9Y2H0.
BgeeQ9Y2H0.
CleanExHS_DLGAP4.
GenevestigatorQ9Y2H0.

Family and domain databases

InterProIPR005026. GKAP.
[Graphical view]
PfamPF03359. GKAP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSDLGAP4. human.
GeneWikiDLGAP4.
GenomeRNAi22839.
NextBio43281.
PROQ9Y2H0.

Entry information

Entry nameDLGP4_HUMAN
AccessionPrimary (citable) accession number: Q9Y2H0
Secondary accession number(s): E1P5T5 expand/collapse secondary AC list , Q5QPG4, Q5T2Y4, Q5T2Y5, Q9H137, Q9H138, Q9H1L7
Entry history
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: July 22, 2008
Last modified: April 16, 2014
This is version 112 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 20

Human chromosome 20: entries, gene names and cross-references to MIM