SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Y2H0

- DLGP4_HUMAN

UniProt

Q9Y2H0 - DLGP4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Disks large-associated protein 4
Gene
DLGAP4, DAP4, KIAA0964, SAPAP4
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May play a role in the molecular organization of synapses and neuronal cell signaling. Could be an adapter protein linking ion channel to the subsynaptic cytoskeleton. May induce enrichment of PSD-95/SAP90 at the plasma membrane.

GO - Molecular functioni

  1. protein binding Source: IntAct

GO - Biological processi

  1. cell-cell signaling Source: InterPro
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large-associated protein 4
Short name:
DAP-4
Alternative name(s):
PSD-95/SAP90-binding protein 4
SAP90/PSD-95-associated protein 4
Short name:
SAPAP-4
Gene namesi
Name:DLGAP4
Synonyms:DAP4, KIAA0964, SAPAP4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 20

Organism-specific databases

HGNCiHGNC:24476. DLGAP4.

Subcellular locationi

GO - Cellular componenti

  1. membrane Source: UniProtKB-SubCell
  2. synapse Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134891458.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 992992Disks large-associated protein 4
PRO_0000174297Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei378 – 3781Phosphoserine By similarity
Modified residuei915 – 9151Phosphothreonine3 Publications
Modified residuei973 – 9731Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9Y2H0.
PaxDbiQ9Y2H0.
PRIDEiQ9Y2H0.

PTM databases

PhosphoSiteiQ9Y2H0.

Expressioni

Gene expression databases

ArrayExpressiQ9Y2H0.
BgeeiQ9Y2H0.
CleanExiHS_DLGAP4.
GenevestigatoriQ9Y2H0.

Organism-specific databases

HPAiHPA054105.
HPA056378.

Interactioni

Subunit structurei

Interacts with DLG1 and DLG4/PSD-95 By similarity.

Binary interactionsi

WithEntry#Exp.IntActNotes
BIN1O004994EBI-722139,EBI-719094
GRB2P629932EBI-722139,EBI-401755
NCK1P163335EBI-722139,EBI-389883
PIK3R1P279862EBI-722139,EBI-79464

Protein-protein interaction databases

BioGridi116513. 8 interactions.
IntActiQ9Y2H0. 14 interactions.
MINTiMINT-8105041.
STRINGi9606.ENSP00000363023.

Structurei

3D structure databases

ProteinModelPortaliQ9Y2H0.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi267 – 2748Poly-Pro

Sequence similaritiesi

Belongs to the SAPAP family.

Phylogenomic databases

eggNOGiNOG331770.
HOVERGENiHBG018957.
InParanoidiQ9Y2H0.
OMAiKNNTAEL.
PhylomeDBiQ9Y2H0.
TreeFamiTF321382.

Family and domain databases

InterProiIPR005026. GKAP.
[Graphical view]
PfamiPF03359. GKAP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9Y2H0-2) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKGLGDSRPR HLSDSLDPPH EPLFAGTDRN PYLLSPTEAF AREARFPGQN    50
TLPGDGLFPL NNQLPPPSST FPRIHYNSHF EVPEESPFPS HAQATKINRL 100
PANLLDQFEK QLPIHRDGFS TLQFPRGEAK ARGESPGRIR HLVHSVQRLF 150
FTKAPSLEGT AGKVGGNGSK KGGMEDGKGR RAKSKERAKA GEPKRRSRSN 200
ISGWWSSDDN LDGEAGAFRS SGPASGLMTL GRQAERSQPR YFMHAYNTIS 250
GHMLKTTKNN TTELTAPPPP PAPPATCPSL GVGTDTNYVK RGSWSTLTLS 300
HAHEVCQKTS ATLDKSLLKS KSCHQGLAYH YLQVPGGGGE WSTTLLSPRE 350
TDAAAEGPIP CRRMRSGSYI KAMGDEDSDE SGGSPKPSPK TAARRQSYLR 400
ATQQSLGEQS NPRRSLDRLD SVDMLLPSKC PSWEEDYTPV SDSLNDSSCI 450
SQIFGQASLI PQLFGHEQQV REAELSDQYE AACESACSEA ESTAAETLDL 500
PLPSYFRSRS HSYLRAIQAG CSQEEDSVSL QSLSPPPSTG SLSNSRTLPS 550
SSCLVAYKKT PPPVPPRTTS KPFISVTVQS STESAQDTYL DSQDHKSEVT 600
SQSGLSNSSD SLDSSTRPPS VTRGGVAPAP EAPEPPPKHA ALKSEQGTLT 650
SSESHPEAAP KRKLSSIGIQ VDCIQPVPKE EPSPATKFQS IGVQVEDDWR 700
SSVPSHSMSS RRDTDSDTQD ANDSSCKSSE RSLPDCTPHP NSISIDAGPR 750
QAPKIAQIKR NLSYGDNSDP ALEASSLPPP DPWLETSSSS PAEPAQPGAC 800
RRDGYWFLKL LQAETERLEG WCCQMDKETK ENNLSEEVLG KVLSAVGSAQ 850
LLMSQKFQQF RGLCEQNLNP DANPRPTAQD LAGFWDLLQL SIEDISMKFD 900
ELYHLKANSW QLVETPEKRK EEKKPPPPVP KKPAKSKPAV SRDKASDASD 950
KQRQEARKRL LAAKRAASVR QNSATESADS IEIYVPEAQT RL 992
Length:992
Mass (Da):108,012
Last modified:July 22, 2008 - v3
Checksum:iF0EBFBE0DE1AC814
GO
Isoform 2 (identifier: Q9Y2H0-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     671-700: VDCIQPVPKEEPSPATKFQSIGVQVEDDWR → ERTRRNGSHLSEDNGPKAIDVMAPSSE

Show »
Length:989
Mass (Da):107,567
Checksum:iB2FD9A2103E052EB
GO
Isoform 3 (identifier: Q9Y2H0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-539: Missing.
     540-550: GSLSNSRTLPS → MALCLELLKQC

Show »
Length:453
Mass (Da):49,478
Checksum:i877C20CA747800EB
GO

Sequence cautioni

The sequence BAA76808.2 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti486 – 4861A → T.
Corresponds to variant rs6019652 [ dbSNP | Ensembl ].
VAR_057716
Natural varianti861 – 8611R → Q.
Corresponds to variant rs2275807 [ dbSNP | Ensembl ].
VAR_057717

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 539539Missing in isoform 3.
VSP_034910Add
BLAST
Alternative sequencei540 – 55011GSLSNSRTLPS → MALCLELLKQC in isoform 3.
VSP_034911Add
BLAST
Alternative sequencei671 – 70030VDCIQ…EDDWR → ERTRRNGSHLSEDNGPKAID VMAPSSE in isoform 2.
VSP_006013Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti229 – 2291T → I in BAA76808. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB023181 mRNA. Translation: BAA76808.2. Different initiation.
AL390374, AL050318 Genomic DNA. Translation: CAI17927.1.
AL390374, AL050318 Genomic DNA. Translation: CAI17928.1.
AL050318, AL390374 Genomic DNA. Translation: CAI23506.1.
AL050318, AL390374 Genomic DNA. Translation: CAI23507.1.
AL390374, AL050318 Genomic DNA. Translation: CAI17929.1.
AL050318, AL390374 Genomic DNA. Translation: CAI23509.1.
CH471077 Genomic DNA. Translation: EAW76140.1.
CH471077 Genomic DNA. Translation: EAW76135.1.
CH471077 Genomic DNA. Translation: EAW76136.1.
BC108706 mRNA. Translation: AAI08707.1.
BC153874 mRNA. Translation: AAI53875.1.
CCDSiCCDS13274.1. [Q9Y2H0-1]
CCDS13275.1. [Q9Y2H0-3]
RefSeqiNP_001035951.1. NM_001042486.3.
NP_055717.2. NM_014902.5. [Q9Y2H0-1]
NP_892118.1. NM_183006.3. [Q9Y2H0-3]
XP_005260386.1. XM_005260329.2. [Q9Y2H0-2]
UniGeneiHs.249600.

Genome annotation databases

EnsembliENST00000339266; ENSP00000341633; ENSG00000080845. [Q9Y2H0-2]
ENST00000340491; ENSP00000345700; ENSG00000080845. [Q9Y2H0-3]
ENST00000373907; ENSP00000363014; ENSG00000080845. [Q9Y2H0-2]
ENST00000373913; ENSP00000363023; ENSG00000080845. [Q9Y2H0-1]
ENST00000401952; ENSP00000384954; ENSG00000080845. [Q9Y2H0-1]
ENST00000594949; ENSP00000470606; ENSG00000269562. [Q9Y2H0-1]
ENST00000595745; ENSP00000469319; ENSG00000269562. [Q9Y2H0-2]
ENST00000596880; ENSP00000471074; ENSG00000269562. [Q9Y2H0-3]
ENST00000597268; ENSP00000472269; ENSG00000269562. [Q9Y2H0-1]
ENST00000598628; ENSP00000469167; ENSG00000269562. [Q9Y2H0-2]
GeneIDi22839.
KEGGihsa:22839.
UCSCiuc002xff.3. human. [Q9Y2H0-1]
uc002xfg.3. human. [Q9Y2H0-3]

Polymorphism databases

DMDMi205831580.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB023181 mRNA. Translation: BAA76808.2 . Different initiation.
AL390374 , AL050318 Genomic DNA. Translation: CAI17927.1 .
AL390374 , AL050318 Genomic DNA. Translation: CAI17928.1 .
AL050318 , AL390374 Genomic DNA. Translation: CAI23506.1 .
AL050318 , AL390374 Genomic DNA. Translation: CAI23507.1 .
AL390374 , AL050318 Genomic DNA. Translation: CAI17929.1 .
AL050318 , AL390374 Genomic DNA. Translation: CAI23509.1 .
CH471077 Genomic DNA. Translation: EAW76140.1 .
CH471077 Genomic DNA. Translation: EAW76135.1 .
CH471077 Genomic DNA. Translation: EAW76136.1 .
BC108706 mRNA. Translation: AAI08707.1 .
BC153874 mRNA. Translation: AAI53875.1 .
CCDSi CCDS13274.1. [Q9Y2H0-1 ]
CCDS13275.1. [Q9Y2H0-3 ]
RefSeqi NP_001035951.1. NM_001042486.3.
NP_055717.2. NM_014902.5. [Q9Y2H0-1 ]
NP_892118.1. NM_183006.3. [Q9Y2H0-3 ]
XP_005260386.1. XM_005260329.2. [Q9Y2H0-2 ]
UniGenei Hs.249600.

3D structure databases

ProteinModelPortali Q9Y2H0.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116513. 8 interactions.
IntActi Q9Y2H0. 14 interactions.
MINTi MINT-8105041.
STRINGi 9606.ENSP00000363023.

PTM databases

PhosphoSitei Q9Y2H0.

Polymorphism databases

DMDMi 205831580.

Proteomic databases

MaxQBi Q9Y2H0.
PaxDbi Q9Y2H0.
PRIDEi Q9Y2H0.

Protocols and materials databases

DNASUi 22839.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000339266 ; ENSP00000341633 ; ENSG00000080845 . [Q9Y2H0-2 ]
ENST00000340491 ; ENSP00000345700 ; ENSG00000080845 . [Q9Y2H0-3 ]
ENST00000373907 ; ENSP00000363014 ; ENSG00000080845 . [Q9Y2H0-2 ]
ENST00000373913 ; ENSP00000363023 ; ENSG00000080845 . [Q9Y2H0-1 ]
ENST00000401952 ; ENSP00000384954 ; ENSG00000080845 . [Q9Y2H0-1 ]
ENST00000594949 ; ENSP00000470606 ; ENSG00000269562 . [Q9Y2H0-1 ]
ENST00000595745 ; ENSP00000469319 ; ENSG00000269562 . [Q9Y2H0-2 ]
ENST00000596880 ; ENSP00000471074 ; ENSG00000269562 . [Q9Y2H0-3 ]
ENST00000597268 ; ENSP00000472269 ; ENSG00000269562 . [Q9Y2H0-1 ]
ENST00000598628 ; ENSP00000469167 ; ENSG00000269562 . [Q9Y2H0-2 ]
GeneIDi 22839.
KEGGi hsa:22839.
UCSCi uc002xff.3. human. [Q9Y2H0-1 ]
uc002xfg.3. human. [Q9Y2H0-3 ]

Organism-specific databases

CTDi 22839.
GeneCardsi GC20P034894.
HGNCi HGNC:24476. DLGAP4.
HPAi HPA054105.
HPA056378.
neXtProti NX_Q9Y2H0.
PharmGKBi PA134891458.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG331770.
HOVERGENi HBG018957.
InParanoidi Q9Y2H0.
OMAi KNNTAEL.
PhylomeDBi Q9Y2H0.
TreeFami TF321382.

Miscellaneous databases

ChiTaRSi DLGAP4. human.
GeneWikii DLGAP4.
GenomeRNAii 22839.
NextBioi 43281.
PROi Q9Y2H0.

Gene expression databases

ArrayExpressi Q9Y2H0.
Bgeei Q9Y2H0.
CleanExi HS_DLGAP4.
Genevestigatori Q9Y2H0.

Family and domain databases

InterProi IPR005026. GKAP.
[Graphical view ]
Pfami PF03359. GKAP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 6:63-70(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  2. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: PNS.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915 AND SER-973, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiDLGP4_HUMAN
AccessioniPrimary (citable) accession number: Q9Y2H0
Secondary accession number(s): E1P5T5
, Q5QPG4, Q5T2Y4, Q5T2Y5, Q9H137, Q9H138, Q9H1L7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: July 22, 2008
Last modified: July 9, 2014
This is version 115 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi