Q9Y2H0 (DLGP4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disks large-associated protein 4 Short name=DAP-4 Alternative name(s): PSD-95/SAP90-binding protein 4 SAP90/PSD-95-associated protein 4 Short name=SAPAP-4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 992 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in the molecular organization of synapses and neuronal cell signaling. Could be an adapter protein linking ion channel to the subsynaptic cytoskeleton. May induce enrichment of PSD-95/SAP90 at the plasma membrane. |
| Subunit structure | Interacts with DLG1 and DLG4/PSD-95 By similarity. |
| Subcellular location | Membrane; Peripheral membrane protein By similarity. |
| Sequence similarities | Belongs to the SAPAP family. |
| Sequence caution | The sequence BAA76808.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell-cell signaling Inferred from electronic annotation. Source: InterPro |
| Cellular component | membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BIN1 | O00499 | 4 | EBI-722139,EBI-719094 | |
| GRB2 | P62993 | 2 | EBI-722139,EBI-401755 | |
| NCK1 | P16333 | 5 | EBI-722139,EBI-389883 | |
| PIK3R1 | P27986 | 2 | EBI-722139,EBI-79464 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y2H0-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y2H0-1) The sequence of this isoform differs from the canonical sequence as follows: 671-700: VDCIQPVPKEEPSPATKFQSIGVQVEDDWR → ERTRRNGSHLSEDNGPKAIDVMAPSSE | ||||||
| Isoform 3 (identifier: Q9Y2H0-3) The sequence of this isoform differs from the canonical sequence as follows: 1-539: Missing. 540-550: GSLSNSRTLPS → MALCLELLKQC |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 992 | 992 | Disks large-associated protein 4 | PRO_0000174297 | |||||
Regions | |||||||||
| Compositional bias | 267 – 274 | 8 | Poly-Pro | ||||||
Amino acid modifications | |||||||||
| Modified residue | 368 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 369 | 1 | Phosphotyrosine Ref.6 | ||||||
| Modified residue | 378 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 397 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 421 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 512 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 665 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 915 | 1 | Phosphothreonine Ref.7 Ref.8 Ref.9 | ||||||
| Modified residue | 973 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 984 | 1 | Phosphotyrosine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 539 | 539 | Missing in isoform 3. | VSP_034910 | |||||
| Alternative sequence | 540 – 550 | 11 | GSLSNSRTLPS → MALCLELLKQC in isoform 3. | VSP_034911 | |||||
| Alternative sequence | 671 – 700 | 30 | VDCIQ…EDDWR → ERTRRNGSHLSEDNGPKAID VMAPSSE in isoform 2. | VSP_006013 | |||||
| Natural variant | 486 | 1 | A → T. Corresponds to variant rs6019652 [ dbSNP | Ensembl ]. | VAR_057716 | |||||
| Natural variant | 861 | 1 | R → Q. Corresponds to variant rs2275807 [ dbSNP | Ensembl ]. | VAR_057717 | |||||
Experimental info | |||||||||
| Sequence conflict | 229 | 1 | T → I in BAA76808. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 6:63-70(1999) [PubMed: 10231032] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: PNS. |
| [5] | "Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling." Wang Y., Du D., Fang L., Yang G., Zhang C., Zeng R., Ullrich A., Lottspeich F., Chen Z. EMBO J. 25:5058-5070(2006) [PubMed: 17053785] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-984, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [6] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-369, MASS SPECTROMETRY. Tissue: Lung carcinoma. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [9] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-915, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB023181 mRNA. Translation: BAA76808.2. Different initiation. AL390374, AL050318 Genomic DNA. Translation: CAI17927.1. AL390374, AL050318 Genomic DNA. Translation: CAI17928.1. AL050318, AL390374 Genomic DNA. Translation: CAI23506.1. AL050318, AL390374 Genomic DNA. Translation: CAI23507.1. AL390374, AL050318 Genomic DNA. Translation: CAI17929.1. AL050318, AL390374 Genomic DNA. Translation: CAI23509.1. CH471077 Genomic DNA. Translation: EAW76140.1. CH471077 Genomic DNA. Translation: EAW76135.1. CH471077 Genomic DNA. Translation: EAW76136.1. BC108706 mRNA. Translation: AAI08707.1. BC153874 mRNA. Translation: AAI53875.1. |
| IPI | IPI00007138. IPI00220581. IPI00411461. |
| RefSeq | NP_001035951.1. NM_001042486.2. NP_055717.2. NM_014902.4. NP_892118.1. NM_183006.2. |
| UniGene | Hs.249600. |
3D structure databases | |
| ProteinModelPortal | Q9Y2H0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9Y2H0. 13 interactions. |
| STRING | Q9Y2H0. |
PTM databases | |
| PhosphoSite | Q9Y2H0. |
Polymorphism databases | |
| DMDM | 205831580. |
Proteomic databases | |
| PRIDE | Q9Y2H0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000339266; ENSP00000341633; ENSG00000080845. ENST00000373907; ENSP00000363014; ENSG00000080845. |
| GeneID | 22839. |
| KEGG | hsa:22839. |
| UCSC | uc002xff.1. human. |
Organism-specific databases | |
| CTD | 22839. |
| GeneCards | GC20P034894. |
| HGNC | HGNC:24476. DLGAP4. |
| neXtProt | NX_Q9Y2H0. |
| PharmGKB | PA134891458. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG18620. |
| GeneTree | ENSGT00550000074473. |
| HOVERGEN | HBG018957. |
| InParanoid | Q9Y2H0. |
| OMA | EGPIPCR. |
| PhylomeDB | Q9Y2H0. |
Gene expression databases | |
| ArrayExpress | Q9Y2H0. |
| Bgee | Q9Y2H0. |
| CleanEx | HS_DLGAP4. |
| Genevestigator | Q9Y2H0. |
| GermOnline | ENSG00000080845. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR005026. GKAP. [Graphical view] |
| Pfam | PF03359. GKAP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 43281. |
Entry information
| Entry name | DLGP4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y2H0 Secondary accession number(s): E1P5T5 Q9H1L7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with