Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large-associated protein 4

Gene

DLGAP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in the molecular organization of synapses and neuronal cell signaling. Could be an adapter protein linking ion channel to the subsynaptic cytoskeleton. May induce enrichment of PSD-95/SAP90 at the plasma membrane.

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000080845-MONOMER.
ReactomeiR-HSA-6794361. Interactions of neurexins and neuroligins at synapses.

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large-associated protein 4
Short name:
DAP-4
Alternative name(s):
PSD-95/SAP90-binding protein 4
SAP90/PSD-95-associated protein 4
Short name:
SAPAP-4
Gene namesi
Name:DLGAP4
Synonyms:DAP4, KIAA0964, SAPAP4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:24476. DLGAP4.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi22839.
OpenTargetsiENSG00000080845.
PharmGKBiPA134891458.

Polymorphism and mutation databases

BioMutaiDLGAP4.
DMDMi205831580.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001742971 – 992Disks large-associated protein 4Add BLAST992

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei206PhosphoserineBy similarity1
Modified residuei207PhosphoserineBy similarity1
Modified residuei291Omega-N-methylarginineBy similarity1
Modified residuei378PhosphoserineBy similarity1
Modified residuei381PhosphoserineBy similarity1
Modified residuei388PhosphoserineBy similarity1
Modified residuei405PhosphoserineBy similarity1
Modified residuei415PhosphoserineBy similarity1
Modified residuei421PhosphoserineBy similarity1
Modified residuei580PhosphoserineBy similarity1
Modified residuei581PhosphoserineBy similarity1
Modified residuei609PhosphoserineBy similarity1
Modified residuei611PhosphoserineBy similarity1
Modified residuei665PhosphoserineCombined sources1
Modified residuei744PhosphoserineCombined sources1
Modified residuei915PhosphothreonineCombined sources1
Modified residuei973PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

EPDiQ9Y2H0.
MaxQBiQ9Y2H0.
PaxDbiQ9Y2H0.
PeptideAtlasiQ9Y2H0.
PRIDEiQ9Y2H0.

PTM databases

iPTMnetiQ9Y2H0.
PhosphoSitePlusiQ9Y2H0.
SwissPalmiQ9Y2H0.

Expressioni

Gene expression databases

BgeeiENSG00000080845.
CleanExiHS_DLGAP4.
ExpressionAtlasiQ9Y2H0. baseline and differential.
GenevisibleiQ9Y2H0. HS.

Organism-specific databases

HPAiHPA054105.
HPA056378.

Interactioni

Subunit structurei

Interacts with DLG1 and DLG4/PSD-95.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
ABI2Q9NYB9-24EBI-12000556,EBI-11096309
BIN1O004994EBI-722139,EBI-719094
GRB2P629932EBI-722139,EBI-401755
NCK1P163335EBI-722139,EBI-389883
NCK2O436394EBI-12000556,EBI-713635
PIK3R1P279862EBI-722139,EBI-79464

Protein-protein interaction databases

BioGridi116513. 17 interactors.
IntActiQ9Y2H0. 34 interactors.
MINTiMINT-8105041.
STRINGi9606.ENSP00000363023.

Structurei

3D structure databases

ProteinModelPortaliQ9Y2H0.
SMRiQ9Y2H0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi267 – 274Poly-Pro8

Sequence similaritiesi

Belongs to the SAPAP family.Curated

Phylogenomic databases

eggNOGiKOG3971. Eukaryota.
ENOG4111JKV. LUCA.
GeneTreeiENSGT00550000074473.
HOVERGENiHBG018957.
InParanoidiQ9Y2H0.
OMAiPSWEEDY.
OrthoDBiEOG091G0J9O.
PhylomeDBiQ9Y2H0.
TreeFamiTF321382.

Family and domain databases

InterProiIPR030527. DLGAP4.
IPR005026. SAPAP.
[Graphical view]
PANTHERiPTHR12353:SF19. PTHR12353:SF19. 2 hits.
PfamiPF03359. GKAP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y2H0-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKGLGDSRPR HLSDSLDPPH EPLFAGTDRN PYLLSPTEAF AREARFPGQN
60 70 80 90 100
TLPGDGLFPL NNQLPPPSST FPRIHYNSHF EVPEESPFPS HAQATKINRL
110 120 130 140 150
PANLLDQFEK QLPIHRDGFS TLQFPRGEAK ARGESPGRIR HLVHSVQRLF
160 170 180 190 200
FTKAPSLEGT AGKVGGNGSK KGGMEDGKGR RAKSKERAKA GEPKRRSRSN
210 220 230 240 250
ISGWWSSDDN LDGEAGAFRS SGPASGLMTL GRQAERSQPR YFMHAYNTIS
260 270 280 290 300
GHMLKTTKNN TTELTAPPPP PAPPATCPSL GVGTDTNYVK RGSWSTLTLS
310 320 330 340 350
HAHEVCQKTS ATLDKSLLKS KSCHQGLAYH YLQVPGGGGE WSTTLLSPRE
360 370 380 390 400
TDAAAEGPIP CRRMRSGSYI KAMGDEDSDE SGGSPKPSPK TAARRQSYLR
410 420 430 440 450
ATQQSLGEQS NPRRSLDRLD SVDMLLPSKC PSWEEDYTPV SDSLNDSSCI
460 470 480 490 500
SQIFGQASLI PQLFGHEQQV REAELSDQYE AACESACSEA ESTAAETLDL
510 520 530 540 550
PLPSYFRSRS HSYLRAIQAG CSQEEDSVSL QSLSPPPSTG SLSNSRTLPS
560 570 580 590 600
SSCLVAYKKT PPPVPPRTTS KPFISVTVQS STESAQDTYL DSQDHKSEVT
610 620 630 640 650
SQSGLSNSSD SLDSSTRPPS VTRGGVAPAP EAPEPPPKHA ALKSEQGTLT
660 670 680 690 700
SSESHPEAAP KRKLSSIGIQ VDCIQPVPKE EPSPATKFQS IGVQVEDDWR
710 720 730 740 750
SSVPSHSMSS RRDTDSDTQD ANDSSCKSSE RSLPDCTPHP NSISIDAGPR
760 770 780 790 800
QAPKIAQIKR NLSYGDNSDP ALEASSLPPP DPWLETSSSS PAEPAQPGAC
810 820 830 840 850
RRDGYWFLKL LQAETERLEG WCCQMDKETK ENNLSEEVLG KVLSAVGSAQ
860 870 880 890 900
LLMSQKFQQF RGLCEQNLNP DANPRPTAQD LAGFWDLLQL SIEDISMKFD
910 920 930 940 950
ELYHLKANSW QLVETPEKRK EEKKPPPPVP KKPAKSKPAV SRDKASDASD
960 970 980 990
KQRQEARKRL LAAKRAASVR QNSATESADS IEIYVPEAQT RL
Length:992
Mass (Da):108,012
Last modified:July 22, 2008 - v3
Checksum:iF0EBFBE0DE1AC814
GO
Isoform 2 (identifier: Q9Y2H0-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     671-700: VDCIQPVPKEEPSPATKFQSIGVQVEDDWR → ERTRRNGSHLSEDNGPKAIDVMAPSSE

Show »
Length:989
Mass (Da):107,567
Checksum:iB2FD9A2103E052EB
GO
Isoform 3 (identifier: Q9Y2H0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-539: Missing.
     540-550: GSLSNSRTLPS → MALCLELLKQC

Show »
Length:453
Mass (Da):49,478
Checksum:i877C20CA747800EB
GO

Sequence cautioni

The sequence BAA76808 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti229T → I in BAA76808 (PubMed:10231032).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057716486A → T.Corresponds to variant rs6019652dbSNPEnsembl.1
Natural variantiVAR_057717861R → Q.Corresponds to variant rs2275807dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0349101 – 539Missing in isoform 3. 1 PublicationAdd BLAST539
Alternative sequenceiVSP_034911540 – 550GSLSNSRTLPS → MALCLELLKQC in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_006013671 – 700VDCIQ…EDDWR → ERTRRNGSHLSEDNGPKAID VMAPSSE in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023181 mRNA. Translation: BAA76808.2. Different initiation.
AL390374, AL050318 Genomic DNA. Translation: CAI17927.1.
AL390374, AL050318 Genomic DNA. Translation: CAI17928.1.
AL050318, AL390374 Genomic DNA. Translation: CAI23506.1.
AL050318, AL390374 Genomic DNA. Translation: CAI23507.1.
AL390374, AL050318 Genomic DNA. Translation: CAI17929.1.
AL050318, AL390374 Genomic DNA. Translation: CAI23509.1.
CH471077 Genomic DNA. Translation: EAW76140.1.
CH471077 Genomic DNA. Translation: EAW76135.1.
CH471077 Genomic DNA. Translation: EAW76136.1.
BC108706 mRNA. Translation: AAI08707.1.
BC153874 mRNA. Translation: AAI53875.1.
CCDSiCCDS13274.1. [Q9Y2H0-1]
CCDS13275.1. [Q9Y2H0-3]
RefSeqiNP_001035951.1. NM_001042486.3.
NP_055717.2. NM_014902.5. [Q9Y2H0-1]
NP_892118.1. NM_183006.3. [Q9Y2H0-3]
XP_011526990.1. XM_011528688.2. [Q9Y2H0-2]
UniGeneiHs.249600.

Genome annotation databases

EnsembliENST00000339266; ENSP00000341633; ENSG00000080845. [Q9Y2H0-2]
ENST00000340491; ENSP00000345700; ENSG00000080845. [Q9Y2H0-3]
ENST00000373907; ENSP00000363014; ENSG00000080845. [Q9Y2H0-2]
ENST00000373913; ENSP00000363023; ENSG00000080845. [Q9Y2H0-1]
ENST00000401952; ENSP00000384954; ENSG00000080845. [Q9Y2H0-1]
GeneIDi22839.
KEGGihsa:22839.
UCSCiuc002xff.4. human. [Q9Y2H0-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023181 mRNA. Translation: BAA76808.2. Different initiation.
AL390374, AL050318 Genomic DNA. Translation: CAI17927.1.
AL390374, AL050318 Genomic DNA. Translation: CAI17928.1.
AL050318, AL390374 Genomic DNA. Translation: CAI23506.1.
AL050318, AL390374 Genomic DNA. Translation: CAI23507.1.
AL390374, AL050318 Genomic DNA. Translation: CAI17929.1.
AL050318, AL390374 Genomic DNA. Translation: CAI23509.1.
CH471077 Genomic DNA. Translation: EAW76140.1.
CH471077 Genomic DNA. Translation: EAW76135.1.
CH471077 Genomic DNA. Translation: EAW76136.1.
BC108706 mRNA. Translation: AAI08707.1.
BC153874 mRNA. Translation: AAI53875.1.
CCDSiCCDS13274.1. [Q9Y2H0-1]
CCDS13275.1. [Q9Y2H0-3]
RefSeqiNP_001035951.1. NM_001042486.3.
NP_055717.2. NM_014902.5. [Q9Y2H0-1]
NP_892118.1. NM_183006.3. [Q9Y2H0-3]
XP_011526990.1. XM_011528688.2. [Q9Y2H0-2]
UniGeneiHs.249600.

3D structure databases

ProteinModelPortaliQ9Y2H0.
SMRiQ9Y2H0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116513. 17 interactors.
IntActiQ9Y2H0. 34 interactors.
MINTiMINT-8105041.
STRINGi9606.ENSP00000363023.

PTM databases

iPTMnetiQ9Y2H0.
PhosphoSitePlusiQ9Y2H0.
SwissPalmiQ9Y2H0.

Polymorphism and mutation databases

BioMutaiDLGAP4.
DMDMi205831580.

Proteomic databases

EPDiQ9Y2H0.
MaxQBiQ9Y2H0.
PaxDbiQ9Y2H0.
PeptideAtlasiQ9Y2H0.
PRIDEiQ9Y2H0.

Protocols and materials databases

DNASUi22839.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339266; ENSP00000341633; ENSG00000080845. [Q9Y2H0-2]
ENST00000340491; ENSP00000345700; ENSG00000080845. [Q9Y2H0-3]
ENST00000373907; ENSP00000363014; ENSG00000080845. [Q9Y2H0-2]
ENST00000373913; ENSP00000363023; ENSG00000080845. [Q9Y2H0-1]
ENST00000401952; ENSP00000384954; ENSG00000080845. [Q9Y2H0-1]
GeneIDi22839.
KEGGihsa:22839.
UCSCiuc002xff.4. human. [Q9Y2H0-2]

Organism-specific databases

CTDi22839.
DisGeNETi22839.
GeneCardsiDLGAP4.
HGNCiHGNC:24476. DLGAP4.
HPAiHPA054105.
HPA056378.
MIMi616191. gene.
neXtProtiNX_Q9Y2H0.
OpenTargetsiENSG00000080845.
PharmGKBiPA134891458.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3971. Eukaryota.
ENOG4111JKV. LUCA.
GeneTreeiENSGT00550000074473.
HOVERGENiHBG018957.
InParanoidiQ9Y2H0.
OMAiPSWEEDY.
OrthoDBiEOG091G0J9O.
PhylomeDBiQ9Y2H0.
TreeFamiTF321382.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000080845-MONOMER.
ReactomeiR-HSA-6794361. Interactions of neurexins and neuroligins at synapses.

Miscellaneous databases

ChiTaRSiDLGAP4. human.
GeneWikiiDLGAP4.
GenomeRNAii22839.
PROiQ9Y2H0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000080845.
CleanExiHS_DLGAP4.
ExpressionAtlasiQ9Y2H0. baseline and differential.
GenevisibleiQ9Y2H0. HS.

Family and domain databases

InterProiIPR030527. DLGAP4.
IPR005026. SAPAP.
[Graphical view]
PANTHERiPTHR12353:SF19. PTHR12353:SF19. 2 hits.
PfamiPF03359. GKAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDLGP4_HUMAN
AccessioniPrimary (citable) accession number: Q9Y2H0
Secondary accession number(s): E1P5T5
, Q5QPG4, Q5T2Y4, Q5T2Y5, Q9H137, Q9H138, Q9H1L7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: July 22, 2008
Last modified: November 30, 2016
This is version 139 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.