Q9Y2D2 (S35A3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 104.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: UDP-N-acetylglucosamine transporter Alternative name(s): Golgi UDP-GlcNAc transporter Solute carrier family 35 member A3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 325 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Uridine diphosphate-N-acetylglucosamine transporter in the Golgi apparatus. |
| Subcellular location | |
| Sequence similarities | Belongs to the nucleotide-sugar transporter family. SLC35A subfamily. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Sugar transport Transport |
| Cellular component | Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | UDP-N-acetylglucosamine metabolic process Traceable author statement Ref.1. Source: ProtInc |
| Cellular_component | Golgi membrane Traceable author statement. Source: Reactome integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | UDP-N-acetylglucosamine transmembrane transporter activity Traceable author statement Ref.1. Source: ProtInc sugar:hydrogen symporter activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y2D2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y2D2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSSRSVLSPVVGTDAPDQHLELKKPQELKEMERLPLANEDKT | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 325 | 325 | UDP-N-acetylglucosamine transporter | PRO_0000213357 | |||||
Regions | |||||||||
| Transmembrane | 8 – 24 | 17 | Helical; Potential | ||||||
| Transmembrane | 42 – 58 | 17 | Helical; Potential | ||||||
| Transmembrane | 138 – 154 | 17 | Helical; Potential | ||||||
| Transmembrane | 173 – 189 | 17 | Helical; Potential | ||||||
| Transmembrane | 209 – 225 | 17 | Helical; Potential | ||||||
| Transmembrane | 246 – 262 | 17 | Helical; Potential | ||||||
| Transmembrane | 268 – 284 | 17 | Helical; Potential | ||||||
| Transmembrane | 295 – 311 | 17 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MSSRSVLSPVVGTDAPDQHL ELKKPQELKEMERLPLANED KT in isoform 2. | VSP_012786 | |||||
Sequences
| ||||||||||||||||||||||||
References
Web resources
| GGDB GlycoGene database |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB021981 mRNA. Translation: BAA77841.1. AK290573 mRNA. Translation: BAF83262.1. CR749816 mRNA. Translation: CAH18676.1. CH471097 Genomic DNA. Translation: EAW72978.1. CH471097 Genomic DNA. Translation: EAW72979.1. |
| IPI | IPI00470810. IPI01011468. |
| RefSeq | NP_001258613.1. NM_001271684.1. NP_001258614.1. NM_001271685.1. NP_036375.1. NM_012243.2. |
| UniGene | Hs.448979. Hs.534953. |
3D structure databases | |
| ProteinModelPortal | Q9Y2D2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9Y2D2. 2 interactions. |
| MINT | MINT-4781806. |
| STRING | 9606.ENSP00000359174. |
Protein family/group databases | |
| TCDB | 2.A.7.12.7. drug/metabolite transporter (DMT) superfamily. |
PTM databases | |
| PhosphoSite | Q9Y2D2. |
Polymorphism databases | |
| DMDM | 9087207. |
Proteomic databases | |
| PaxDb | Q9Y2D2. |
| PRIDE | Q9Y2D2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000370153; ENSP00000359172; ENSG00000117620. ENST00000370155; ENSP00000359174; ENSG00000117620. ENST00000427993; ENSP00000414947; ENSG00000117620. ENST00000533028; ENSP00000433849; ENSG00000117620. |
| GeneID | 23443. |
| KEGG | hsa:23443. |
| UCSC | uc001dsp.1. human. uc001dsr.1. human. |
Organism-specific databases | |
| CTD | 23443. |
| GeneCards | GC01P100435. |
| HGNC | HGNC:11023. SLC35A3. |
| HPA | HPA015253. |
| MIM | 605632. gene. |
| neXtProt | NX_Q9Y2D2. |
| PharmGKB | PA35891. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0697. |
| HOGENOM | HOG000216649. |
| HOVERGEN | HBG054025. |
| InParanoid | Q9Y2D2. |
| KO | K15272. |
| OrthoDB | EOG4V9TR3. |
| PhylomeDB | Q9Y2D2. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | Q9Y2D2. |
| Bgee | Q9Y2D2. |
| CleanEx | HS_SLC35A3. |
| Genevestigator | Q9Y2D2. |
| GermOnline | ENSG00000117620. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007271. Nuc_sug_transpt. IPR021189. UDP/CMP-sugar_transptr. IPR004689. UDPgal_transpt. [Graphical view] |
| PANTHER | PTHR10231. PTHR10231. 1 hit. |
| Pfam | PF04142. Nuc_sug_transp. 1 hit. [Graphical view] |
| PIRSF | PIRSF005799. UDP-gal_transpt. 1 hit. |
| TIGRFAMs | TIGR00803. nst. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SLC35A3. human. |
| GenomeRNAi | 23443. |
| NextBio | 45719. |
| SOURCE | Search... |
Entry information
| Entry name | S35A3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y2D2 Secondary accession number(s): A8K3F8, D3DT54, Q68CR2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
