Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y2B5

- VP9D1_HUMAN

UniProt

Q9Y2B5 - VP9D1_HUMAN

Protein

VPS9 domain-containing protein 1

Gene

VPS9D1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 75 (01 Oct 2014)
      Sequence version 2 (11 Jan 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. GTPase activator activity Source: UniProtKB-KW
    2. transporter activity Source: ProtInc

    GO - Biological processi

    1. ATP synthesis coupled proton transport Source: ProtInc

    Keywords - Molecular functioni

    GTPase activation

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    VPS9 domain-containing protein 1
    Alternative name(s):
    Protein ATP-BL
    Gene namesi
    Name:VPS9D1
    Synonyms:ATPBL, C16orf7
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:13526. VPS9D1.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA25562.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 631631VPS9 domain-containing protein 1PRO_0000079279Add
    BLAST

    Proteomic databases

    PaxDbiQ9Y2B5.
    PRIDEiQ9Y2B5.

    PTM databases

    PhosphoSiteiQ9Y2B5.

    Expressioni

    Tissue specificityi

    Ubiquitous.1 Publication

    Gene expression databases

    ArrayExpressiQ9Y2B5.
    BgeeiQ9Y2B5.
    CleanExiHS_C16orf7.
    GenevestigatoriQ9Y2B5.

    Organism-specific databases

    HPAiHPA007847.
    HPA023620.

    Interactioni

    Protein-protein interaction databases

    BioGridi114969. 1 interaction.
    IntActiQ9Y2B5. 1 interaction.
    MINTiMINT-7034555.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9Y2B5.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini467 – 630164VPS9PROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili187 – 22135Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 1 VPS9 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG70432.
    OMAiCPQKKLE.
    PhylomeDBiQ9Y2B5.
    TreeFamiTF332037.

    Family and domain databases

    InterProiIPR003123. VPS9.
    [Graphical view]
    PfamiPF02204. VPS9. 1 hit.
    [Graphical view]
    PROSITEiPS51205. VPS9. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9Y2B5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAAAGDGTV KPLQSAMKLA NGAIELDTGN RPREAYTEYL RSIHYISQVL    50
    LEEVETTKEA GETVPPDTSK MLKLAQQCLE RAQSTAAKLG KTRLKPTMPA 100
    AAPIPQPAGR HRRVYSDEGG KLSPFLPPEI FQKLQGAESQ SCKKELTPLE 150
    EASLQNQKLK AAYEARMARL DPSQAMQKTS LTLSLQRQMM ENLVIAKARE 200
    ETLQRKMEER RLRLQEAANR RFCSQVALTP EEREQRALYA AILEYEQDHD 250
    WPKHWKAKLK RNPGDLSLVT SLVSHLLSLP DHPIAQLLRR LQCSVYSALY 300
    PAVSRAAAPA PGCCPPTPNP GSRRLRPSQS LHCMLSPPEP SAAPRPQDSP 350
    PTPPLQPGPV GSPSPLGDTA SGLPDKDSSF EDLEQFLGTS ERQGRGRGVQ 400
    PEPQLQQLKT AVEEIHNAVD RLLSLTLLAF EGLNTAASKD RCLACIEEPF 450
    FSPLWPLLLA LYRSVHRARE AALSRSMELY RNAPPTAIGI PTKLLPQNPE 500
    AKGATGYPYC AAAQELGLLV LESCPQKKLE CIVRTLRIIC VCAEDYCPTP 550
    EATPQAGPPP IAAAAIGADD LLPILSFVVL RSGLPQLVSE CAALEEFIHE 600
    GYLIGEEGYC LTSLQSALSY VELLPRGGLA K 631
    Length:631
    Mass (Da):68,956
    Last modified:January 11, 2011 - v2
    Checksum:i0C302E7BA496B27A
    GO
    Isoform 2 (identifier: Q9Y2B5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-33: MAAAAGDGTVKPLQSAMKLANGAIELDTGNRPR → MLLCPAQKTV...DPTLSLSWTQ

    Note: No experimental confirmation available.

    Show »
    Length:662
    Mass (Da):72,933
    Checksum:iDB9CF0ABE288A070
    GO

    Sequence cautioni

    The sequence BAA76711.1 differs from that shown. Reason: Frameshift at several positions.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti225 – 2262QV → KF in BAA76711. (PubMed:10231027)Curated
    Sequence conflicti392 – 3921R → P in BAA76711. (PubMed:10231027)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3333MAAAA…GNRPR → MLLCPAQKTVFRLQLTTAAQ CLWVYLRDKQVVVFLAYPTR APGRNNGVTSLHWPDPTLSL SWTQ in isoform 2. 1 PublicationVSP_040306Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB018551 mRNA. Translation: BAA76711.1. Frameshift.
    AC010538 Genomic DNA. No translation available.
    CCDSiCCDS42220.1. [Q9Y2B5-1]
    RefSeqiNP_004904.2. NM_004913.2. [Q9Y2B5-1]
    UniGeneiHs.164410.

    Genome annotation databases

    EnsembliENST00000389386; ENSP00000374037; ENSG00000075399. [Q9Y2B5-1]
    GeneIDi9605.
    KEGGihsa:9605.
    UCSCiuc002fol.1. human. [Q9Y2B5-1]

    Polymorphism databases

    DMDMi317373349.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB018551 mRNA. Translation: BAA76711.1 . Frameshift.
    AC010538 Genomic DNA. No translation available.
    CCDSi CCDS42220.1. [Q9Y2B5-1 ]
    RefSeqi NP_004904.2. NM_004913.2. [Q9Y2B5-1 ]
    UniGenei Hs.164410.

    3D structure databases

    ProteinModelPortali Q9Y2B5.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114969. 1 interaction.
    IntActi Q9Y2B5. 1 interaction.
    MINTi MINT-7034555.

    PTM databases

    PhosphoSitei Q9Y2B5.

    Polymorphism databases

    DMDMi 317373349.

    Proteomic databases

    PaxDbi Q9Y2B5.
    PRIDEi Q9Y2B5.

    Protocols and materials databases

    DNASUi 9605.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000389386 ; ENSP00000374037 ; ENSG00000075399 . [Q9Y2B5-1 ]
    GeneIDi 9605.
    KEGGi hsa:9605.
    UCSCi uc002fol.1. human. [Q9Y2B5-1 ]

    Organism-specific databases

    CTDi 9605.
    GeneCardsi GC16M089774.
    H-InvDB HIX0202318.
    HGNCi HGNC:13526. VPS9D1.
    HPAi HPA007847.
    HPA023620.
    neXtProti NX_Q9Y2B5.
    PharmGKBi PA25562.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG70432.
    OMAi CPQKKLE.
    PhylomeDBi Q9Y2B5.
    TreeFami TF332037.

    Miscellaneous databases

    ChiTaRSi C16orf7. human.
    GeneWikii C16orf7.
    GenomeRNAii 9605.
    NextBioi 36039.

    Gene expression databases

    ArrayExpressi Q9Y2B5.
    Bgeei Q9Y2B5.
    CleanExi HS_C16orf7.
    Genevestigatori Q9Y2B5.

    Family and domain databases

    InterProi IPR003123. VPS9.
    [Graphical view ]
    Pfami PF02204. VPS9. 1 hit.
    [Graphical view ]
    PROSITEi PS51205. VPS9. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation and mapping of putative b subunit of human ATPase (ATP-BL) from human leukocytes."
      Sugimoto J., Hatakeyama T., Isobe M.
      DNA Res. 6:29-35(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
      Tissue: Leukocyte.
    2. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

    Entry informationi

    Entry nameiVP9D1_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y2B5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 19, 2005
    Last sequence update: January 11, 2011
    Last modified: October 1, 2014
    This is version 75 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3