Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Y2B5

- VP9D1_HUMAN

UniProt

Q9Y2B5 - VP9D1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

VPS9 domain-containing protein 1

Gene

VPS9D1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  1. GTPase activator activity Source: UniProtKB-KW
  2. transporter activity Source: ProtInc

GO - Biological processi

  1. ATP synthesis coupled proton transport Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Names & Taxonomyi

Protein namesi
Recommended name:
VPS9 domain-containing protein 1
Alternative name(s):
Protein ATP-BL
Gene namesi
Name:VPS9D1
Synonyms:ATPBL, C16orf7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:13526. VPS9D1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25562.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 631631VPS9 domain-containing protein 1PRO_0000079279Add
BLAST

Proteomic databases

PaxDbiQ9Y2B5.
PRIDEiQ9Y2B5.

PTM databases

PhosphoSiteiQ9Y2B5.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiQ9Y2B5.
CleanExiHS_C16orf7.
ExpressionAtlasiQ9Y2B5. baseline and differential.
GenevestigatoriQ9Y2B5.

Organism-specific databases

HPAiHPA007847.
HPA023620.

Interactioni

Protein-protein interaction databases

BioGridi114969. 1 interaction.
IntActiQ9Y2B5. 1 interaction.
MINTiMINT-7034555.

Structurei

3D structure databases

ProteinModelPortaliQ9Y2B5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini467 – 630164VPS9PROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili187 – 22135Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Contains 1 VPS9 domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG70432.
GeneTreeiENSGT00390000015057.
InParanoidiQ9Y2B5.
OMAiCPQKKLE.
PhylomeDBiQ9Y2B5.
TreeFamiTF332037.

Family and domain databases

InterProiIPR003123. VPS9.
[Graphical view]
PfamiPF02204. VPS9. 1 hit.
[Graphical view]
PROSITEiPS51205. VPS9. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9Y2B5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAAGDGTV KPLQSAMKLA NGAIELDTGN RPREAYTEYL RSIHYISQVL
60 70 80 90 100
LEEVETTKEA GETVPPDTSK MLKLAQQCLE RAQSTAAKLG KTRLKPTMPA
110 120 130 140 150
AAPIPQPAGR HRRVYSDEGG KLSPFLPPEI FQKLQGAESQ SCKKELTPLE
160 170 180 190 200
EASLQNQKLK AAYEARMARL DPSQAMQKTS LTLSLQRQMM ENLVIAKARE
210 220 230 240 250
ETLQRKMEER RLRLQEAANR RFCSQVALTP EEREQRALYA AILEYEQDHD
260 270 280 290 300
WPKHWKAKLK RNPGDLSLVT SLVSHLLSLP DHPIAQLLRR LQCSVYSALY
310 320 330 340 350
PAVSRAAAPA PGCCPPTPNP GSRRLRPSQS LHCMLSPPEP SAAPRPQDSP
360 370 380 390 400
PTPPLQPGPV GSPSPLGDTA SGLPDKDSSF EDLEQFLGTS ERQGRGRGVQ
410 420 430 440 450
PEPQLQQLKT AVEEIHNAVD RLLSLTLLAF EGLNTAASKD RCLACIEEPF
460 470 480 490 500
FSPLWPLLLA LYRSVHRARE AALSRSMELY RNAPPTAIGI PTKLLPQNPE
510 520 530 540 550
AKGATGYPYC AAAQELGLLV LESCPQKKLE CIVRTLRIIC VCAEDYCPTP
560 570 580 590 600
EATPQAGPPP IAAAAIGADD LLPILSFVVL RSGLPQLVSE CAALEEFIHE
610 620 630
GYLIGEEGYC LTSLQSALSY VELLPRGGLA K
Length:631
Mass (Da):68,956
Last modified:January 11, 2011 - v2
Checksum:i0C302E7BA496B27A
GO
Isoform 2 (identifier: Q9Y2B5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MAAAAGDGTVKPLQSAMKLANGAIELDTGNRPR → MLLCPAQKTV...DPTLSLSWTQ

Note: No experimental confirmation available.

Show »
Length:662
Mass (Da):72,933
Checksum:iDB9CF0ABE288A070
GO

Sequence cautioni

The sequence BAA76711.1 differs from that shown. Reason: Frameshift at several positions. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti225 – 2262QV → KF in BAA76711. (PubMed:10231027)Curated
Sequence conflicti392 – 3921R → P in BAA76711. (PubMed:10231027)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3333MAAAA…GNRPR → MLLCPAQKTVFRLQLTTAAQ CLWVYLRDKQVVVFLAYPTR APGRNNGVTSLHWPDPTLSL SWTQ in isoform 2. 1 PublicationVSP_040306Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018551 mRNA. Translation: BAA76711.1. Frameshift.
AC010538 Genomic DNA. No translation available.
CCDSiCCDS42220.1. [Q9Y2B5-1]
RefSeqiNP_004904.2. NM_004913.2. [Q9Y2B5-1]
UniGeneiHs.164410.

Genome annotation databases

EnsembliENST00000389386; ENSP00000374037; ENSG00000075399. [Q9Y2B5-1]
GeneIDi9605.
KEGGihsa:9605.
UCSCiuc002fol.1. human. [Q9Y2B5-1]

Polymorphism databases

DMDMi317373349.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018551 mRNA. Translation: BAA76711.1 . Frameshift.
AC010538 Genomic DNA. No translation available.
CCDSi CCDS42220.1. [Q9Y2B5-1 ]
RefSeqi NP_004904.2. NM_004913.2. [Q9Y2B5-1 ]
UniGenei Hs.164410.

3D structure databases

ProteinModelPortali Q9Y2B5.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114969. 1 interaction.
IntActi Q9Y2B5. 1 interaction.
MINTi MINT-7034555.

PTM databases

PhosphoSitei Q9Y2B5.

Polymorphism databases

DMDMi 317373349.

Proteomic databases

PaxDbi Q9Y2B5.
PRIDEi Q9Y2B5.

Protocols and materials databases

DNASUi 9605.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000389386 ; ENSP00000374037 ; ENSG00000075399 . [Q9Y2B5-1 ]
GeneIDi 9605.
KEGGi hsa:9605.
UCSCi uc002fol.1. human. [Q9Y2B5-1 ]

Organism-specific databases

CTDi 9605.
GeneCardsi GC16M089774.
H-InvDB HIX0202318.
HGNCi HGNC:13526. VPS9D1.
HPAi HPA007847.
HPA023620.
neXtProti NX_Q9Y2B5.
PharmGKBi PA25562.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG70432.
GeneTreei ENSGT00390000015057.
InParanoidi Q9Y2B5.
OMAi CPQKKLE.
PhylomeDBi Q9Y2B5.
TreeFami TF332037.

Miscellaneous databases

GeneWikii C16orf7.
GenomeRNAii 9605.
NextBioi 36039.

Gene expression databases

Bgeei Q9Y2B5.
CleanExi HS_C16orf7.
ExpressionAtlasi Q9Y2B5. baseline and differential.
Genevestigatori Q9Y2B5.

Family and domain databases

InterProi IPR003123. VPS9.
[Graphical view ]
Pfami PF02204. VPS9. 1 hit.
[Graphical view ]
PROSITEi PS51205. VPS9. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and mapping of putative b subunit of human ATPase (ATP-BL) from human leukocytes."
    Sugimoto J., Hatakeyama T., Isobe M.
    DNA Res. 6:29-35(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
    Tissue: Leukocyte.
  2. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiVP9D1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y2B5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: January 11, 2011
Last modified: November 26, 2014
This is version 77 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3