Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Y2B5 (VP9D1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 74. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
VPS9 domain-containing protein 1
Alternative name(s):
Protein ATP-BL
Gene names
Name:VPS9D1
Synonyms:ATPBL, C16orf7
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length631 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Tissue specificity

Ubiquitous. Ref.1

Sequence similarities

Contains 1 VPS9 domain.

Sequence caution

The sequence BAA76711.1 differs from that shown. Reason: Frameshift at several positions.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   DomainCoiled coil
   Molecular functionGTPase activation
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processATP synthesis coupled proton transport

Traceable author statement Ref.1. Source: ProtInc

   Molecular_functionGTPase activator activity

Inferred from electronic annotation. Source: UniProtKB-KW

transporter activity

Traceable author statement Ref.1. Source: ProtInc

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9Y2B5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9Y2B5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MAAAAGDGTVKPLQSAMKLANGAIELDTGNRPR → MLLCPAQKTV...DPTLSLSWTQ
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 631631VPS9 domain-containing protein 1
PRO_0000079279

Regions

Domain467 – 630164VPS9
Coiled coil187 – 22135 Potential

Natural variations

Alternative sequence1 – 3333MAAAA…GNRPR → MLLCPAQKTVFRLQLTTAAQ CLWVYLRDKQVVVFLAYPTR APGRNNGVTSLHWPDPTLSL SWTQ in isoform 2.
VSP_040306

Experimental info

Sequence conflict225 – 2262QV → KF in BAA76711. Ref.1
Sequence conflict3921R → P in BAA76711. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 11, 2011. Version 2.
Checksum: 0C302E7BA496B27A

FASTA63168,956
        10         20         30         40         50         60 
MAAAAGDGTV KPLQSAMKLA NGAIELDTGN RPREAYTEYL RSIHYISQVL LEEVETTKEA 

        70         80         90        100        110        120 
GETVPPDTSK MLKLAQQCLE RAQSTAAKLG KTRLKPTMPA AAPIPQPAGR HRRVYSDEGG 

       130        140        150        160        170        180 
KLSPFLPPEI FQKLQGAESQ SCKKELTPLE EASLQNQKLK AAYEARMARL DPSQAMQKTS 

       190        200        210        220        230        240 
LTLSLQRQMM ENLVIAKARE ETLQRKMEER RLRLQEAANR RFCSQVALTP EEREQRALYA 

       250        260        270        280        290        300 
AILEYEQDHD WPKHWKAKLK RNPGDLSLVT SLVSHLLSLP DHPIAQLLRR LQCSVYSALY 

       310        320        330        340        350        360 
PAVSRAAAPA PGCCPPTPNP GSRRLRPSQS LHCMLSPPEP SAAPRPQDSP PTPPLQPGPV 

       370        380        390        400        410        420 
GSPSPLGDTA SGLPDKDSSF EDLEQFLGTS ERQGRGRGVQ PEPQLQQLKT AVEEIHNAVD 

       430        440        450        460        470        480 
RLLSLTLLAF EGLNTAASKD RCLACIEEPF FSPLWPLLLA LYRSVHRARE AALSRSMELY 

       490        500        510        520        530        540 
RNAPPTAIGI PTKLLPQNPE AKGATGYPYC AAAQELGLLV LESCPQKKLE CIVRTLRIIC 

       550        560        570        580        590        600 
VCAEDYCPTP EATPQAGPPP IAAAAIGADD LLPILSFVVL RSGLPQLVSE CAALEEFIHE 

       610        620        630 
GYLIGEEGYC LTSLQSALSY VELLPRGGLA K 

« Hide

Isoform 2 [UniParc].

Checksum: DB9CF0ABE288A070
Show »

FASTA66272,933

References

« Hide 'large scale' references
[1]"Isolation and mapping of putative b subunit of human ATPase (ATP-BL) from human leukocytes."
Sugimoto J., Hatakeyama T., Isobe M.
DNA Res. 6:29-35(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
Tissue: Leukocyte.
[2]"The sequence and analysis of duplication-rich human chromosome 16."
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. expand/collapse author list , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB018551 mRNA. Translation: BAA76711.1. Frameshift.
AC010538 Genomic DNA. No translation available.
CCDSCCDS42220.1. [Q9Y2B5-1]
RefSeqNP_004904.2. NM_004913.2. [Q9Y2B5-1]
UniGeneHs.164410.

3D structure databases

ProteinModelPortalQ9Y2B5.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114969. 1 interaction.
IntActQ9Y2B5. 1 interaction.
MINTMINT-7034555.

PTM databases

PhosphoSiteQ9Y2B5.

Polymorphism databases

DMDM317373349.

Proteomic databases

PaxDbQ9Y2B5.
PRIDEQ9Y2B5.

Protocols and materials databases

DNASU9605.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000389386; ENSP00000374037; ENSG00000075399. [Q9Y2B5-1]
GeneID9605.
KEGGhsa:9605.
UCSCuc002fol.1. human. [Q9Y2B5-1]

Organism-specific databases

CTD9605.
GeneCardsGC16M089774.
H-InvDBHIX0202318.
HGNCHGNC:13526. VPS9D1.
HPAHPA007847.
HPA023620.
neXtProtNX_Q9Y2B5.
PharmGKBPA25562.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG70432.
OMACPQKKLE.
PhylomeDBQ9Y2B5.
TreeFamTF332037.

Gene expression databases

ArrayExpressQ9Y2B5.
BgeeQ9Y2B5.
CleanExHS_C16orf7.
GenevestigatorQ9Y2B5.

Family and domain databases

InterProIPR003123. VPS9.
[Graphical view]
PfamPF02204. VPS9. 1 hit.
[Graphical view]
PROSITEPS51205. VPS9. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSC16orf7. human.
GeneWikiC16orf7.
GenomeRNAi9605.
NextBio36039.

Entry information

Entry nameVP9D1_HUMAN
AccessionPrimary (citable) accession number: Q9Y2B5
Entry history
Integrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: January 11, 2011
Last modified: July 9, 2014
This is version 74 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM