Q9Y2B5 (VP9D1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 66.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: VPS9 domain-containing protein 1 Alternative name(s): Protein ATP-BL | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 631 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Tissue specificity | Ubiquitous. Ref.1 |
| Sequence similarities | Contains 1 VPS9 domain. |
| Sequence caution | The sequence BAA76711.1 differs from that shown. Reason: Frameshift at several positions. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Molecular function | GTPase activation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | ATP synthesis coupled proton transport Traceable author statement Ref.1. Source: ProtInc positive regulation of GTPase activityInferred from electronic annotation. Source: GOC |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA nucleusInferred from direct assay. Source: HPA |
| Molecular_function | GTPase activator activity Inferred from electronic annotation. Source: UniProtKB-KW transporter activityTraceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y2B5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y2B5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MAAAAGDGTVKPLQSAMKLANGAIELDTGNRPR → MLLCPAQKTV...DPTLSLSWTQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 631 | 631 | VPS9 domain-containing protein 1 | PRO_0000079279 | |||||
Regions | |||||||||
| Domain | 467 – 630 | 164 | VPS9 | ||||||
| Coiled coil | 187 – 221 | 35 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 33 | 33 | MAAAA…GNRPR → MLLCPAQKTVFRLQLTTAAQ CLWVYLRDKQVVVFLAYPTR APGRNNGVTSLHWPDPTLSL SWTQ in isoform 2. | VSP_040306 | |||||
Experimental info | |||||||||
| Sequence conflict | 225 – 226 | 2 | QV → KF in BAA76711. Ref.1 | ||||||
| Sequence conflict | 392 | 1 | R → P in BAA76711. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and mapping of putative b subunit of human ATPase (ATP-BL) from human leukocytes." Sugimoto J., Hatakeyama T., Isobe M. DNA Res. 6:29-35(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY. Tissue: Leukocyte. |
| [2] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB018551 mRNA. Translation: BAA76711.1. Frameshift. AC010538 Genomic DNA. No translation available. |
| IPI | IPI00784021. IPI00973529. |
| RefSeq | NP_004904.2. NM_004913.2. |
| UniGene | Hs.164410. |
3D structure databases | |
| ProteinModelPortal | Q9Y2B5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-7034555. |
PTM databases | |
| PhosphoSite | Q9Y2B5. |
Polymorphism databases | |
| DMDM | 71153207. |
Proteomic databases | |
| PaxDb | Q9Y2B5. |
| PRIDE | Q9Y2B5. |
Protocols and materials databases | |
| DNASU | 9605. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000389386; ENSP00000374037; ENSG00000075399. |
| GeneID | 9605. |
| KEGG | hsa:9605. |
| UCSC | uc002fol.1. human. |
Organism-specific databases | |
| CTD | 9605. |
| GeneCards | GC16M089773. |
| H-InvDB | HIX0202318. |
| HGNC | HGNC:13526. VPS9D1. |
| HPA | HPA007847. HPA023620. |
| neXtProt | NX_Q9Y2B5. |
| PharmGKB | PA25562. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG70432. |
| OMA | IHNAIDR. |
Gene expression databases | |
| ArrayExpress | Q9Y2B5. |
| Bgee | Q9Y2B5. |
| CleanEx | HS_C16orf7. |
| Genevestigator | Q9Y2B5. |
| GermOnline | ENSG00000075399. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003123. VPS9. [Graphical view] |
| Pfam | PF02204. VPS9. 1 hit. [Graphical view] |
| PROSITE | PS51205. VPS9. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | C16orf7. human. |
| GenomeRNAi | 9605. |
| NextBio | 36039. |
Entry information
| Entry name | VP9D1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y2B5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
