Q9Y251 (HPSE_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Heparanase EC=3.2.1.166 Alternative name(s): Endo-glucoronidase Heparanase-1 Short name=Hpa1 Cleaved into the following 2 chains: | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 543 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Endoglycosidase that cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Participates in extracellular matrix (ECM) degradation and remodeling. Selectively cleaves the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying either a 3-O-sulfo or a 6-O-sulfo group. Can also cleave the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying a 2-O-sulfo group, but not linkages between a glucuronic acid unit and a 2-O-sulfated iduronic acid moiety. It is essentially inactive at neutral pH but becomes active under acidic conditions such as during tumor invasion and in inflammatory processes. Facilitates cell migration associated with metastasis, wound healing and inflammation. Enhances shedding of syndecans, and increases endothelial invasion and angiogenesis in myelomas. Acts as procoagulant by increasing the generation of activation factor X in the presence of tissue factor and activation factor VII. Increases cell adhesion to the extacellular matrix (ECM), independent of its enzymatic activity. Induces AKT1/PKB phosphorylation via lipid rafts increasing cell mobility and invasion. Heparin increases this AKT1/PKB activation. Regulates osteogenesis. Enhances angiogenesis through up-regulation of SRC-mediated activation of VEGF. Implicated in hair follicle inner root sheath differentiation and hair homeostasis. Ref.16 Ref.19 Ref.21 Ref.27 Ref.29 Ref.30 Ref.31 Ref.33 Ref.35 Ref.36 Ref.38 Ref.39 |
| Catalytic activity | Endohydrolysis of (1->4)-beta-D-glycosidic bonds of heparan sulfate chains in heparan sulfate proteoglycan. Ref.16 Ref.17 Ref.18 Ref.34 Ref.35 Ref.36 |
| Enzyme regulation | Inhibited by EDTA, laminarin sulfate and, to a lower extent, by heparin and sulfamin and activated by calcium and magnesium By similarity. |
| Subunit structure | Heterodimer; heterodimer formation between the 8 kDa and the 50 kDa subunits is required for enzyme activity. Interacts with TF; the interaction, inhibited by heparin, enhances the generation of activated factor X and activates coagulation. Interacts with HRG; the interaction is enhanced at acidic pH, partially inhibits binding of HPSE to cell surface receptors and modulates its enzymatic activity. Interacts with SDC1; the interaction enhances the shedding of SDC1. Interacts with HPSE2. Ref.7 Ref.15 Ref.18 Ref.34 Ref.35 Ref.37 |
| Subcellular location | Lysosome membrane; Peripheral membrane protein. Secreted. Nucleus. Note: Proheparanase is secreted via vesicles of the Golgi. Interacts with cell membrane heparan sulfate proteoglycans (HSPGs). Endocytosed and accumulates in endosomes. Transferred to lysosomes where it is proteolytically cleaved to produce the active enzyme. Under certain stimuli, transferred to the cell surface. Associates with lipid rafts. Colocalizes with SDC1 in endosomal/lysosomal vesicles. Accumulates in perinuclear lysosomal vesicles. Heparin retains proheparanase in the extracellular medium By similarity. Ref.6 Ref.15 Ref.17 Ref.22 Ref.23 Ref.24 Ref.25 Ref.31 Ref.38 |
| Tissue specificity | Highly expressed in placenta and spleen and weakly expressed in lymph node, thymus, peripheral blood leukocytes, bone marrow, endothelial cells, fetal liver and tumor tissues. Also expressed in hair follicles, specifically in both Henle's and Huxley's layers of inner the root sheath (IRS) at anagen phase. Ref.1 Ref.4 Ref.5 Ref.29 Ref.38 |
| Post-translational modification | Proteolytically processed. The cleavage of the 65 kDa form leads to the generation of a linker peptide, and 8 kDa and 50 kDa products. The active form, the 8/50 kDa heterodimer, is resistant to degradation. Complete removal of the linker peptide appears to be a prerequisite to the complete activation of the enzyme. N-glycosylated. Glycosylation of the 50 kDa subunit appears to be essential for its solubility. Ref.3 Ref.7 Ref.20 |
| Sequence similarities | Belongs to the glycosyl hydrolase 79 family. |
| Biophysicochemical properties | pH dependence: |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y251-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y251-2) Also known as: 55 kDa; splice 5; The sequence of this isoform differs from the canonical sequence as follows: 167-225: RSSVDVLYTFANCSGLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSKGYNISWELGNE → K | ||||||
| Note: Escapes proteolytic cleavage, devoid of HS degradation activity. | ||||||
| Isoform 3 (identifier: Q9Y251-3) The sequence of this isoform differs from the canonical sequence as follows: 329-402: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 35 | 35 | Ref.7 | ||||||
| Chain | 36 – 109 | 74 | Heparanase 8 kDa subunit | PRO_0000042260 | |||||
| Propeptide | 110 – 157 | 48 | Linker peptide | PRO_0000042261 | |||||
| Chain | 158 – 543 | 386 | Heparanase 50 kDa subunit | PRO_0000042262 | |||||
Regions | |||||||||
| Region | 158 – 162 | 5 | Heparin/HS-binding | ||||||
| Region | 270 – 280 | 11 | Heparin/HS-binding | ||||||
| Region | 527 – 543 | 17 | Required for transferring proheparanase to the Golgi apparatus, secretion and subsequent enzyme activity and for enhancement of PKB/AKT1 phosphorylation | ||||||
Sites | |||||||||
| Active site | 225 | 1 | Proton donor Potential | ||||||
| Active site | 343 | 1 | Nucleophile Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 162 | 1 | N-linked (GlcNAc...) Ref.20 | ||||||
| Glycosylation | 178 | 1 | N-linked (GlcNAc...) Ref.20 | ||||||
| Glycosylation | 200 | 1 | N-linked (GlcNAc...) Ref.20 | ||||||
| Glycosylation | 217 | 1 | N-linked (GlcNAc...) Ref.20 Ref.28 Ref.32 | ||||||
| Glycosylation | 238 | 1 | N-linked (GlcNAc...) Ref.20 Ref.32 | ||||||
| Glycosylation | 459 | 1 | N-linked (GlcNAc...) Ref.20 | ||||||
Natural variations | |||||||||
| Alternative sequence | 167 – 225 | 59 | RSSVD…ELGNE → K in isoform 2. | VSP_044537 | |||||
| Alternative sequence | 329 – 402 | 74 | Missing in isoform 3. | VSP_044664 | |||||
| Natural variant | 260 | 1 | N → S in some hepatocellular carcinoma. Ref.40 | VAR_023600 | |||||
| Natural variant | 307 | 1 | K → R. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.8 Ref.9 Ref.10 Ref.11 Ref.13 Corresponds to variant rs11099592 [ dbSNP | Ensembl ]. | VAR_068907 | |||||
Experimental info | |||||||||
| Mutagenesis | 156 | 1 | Y → A or E: Alteration of the correct processing of heparanase which results in the cleavage at an upstream site in the linker peptide and no activation of proheparanase. Ref.25 | ||||||
| Mutagenesis | 156 | 1 | Y → V: Normal processing. Ref.25 | ||||||
| Mutagenesis | 158 | 1 | K → A: No association with GS-modified heparin; when associated with K-158. Ref.26 | ||||||
| Mutagenesis | 161 | 1 | K → A: Two-fold increase in the level of secretion upon addition of GS-modified heparin. No association with GS-modified heparin; when associated with K-161. Ref.26 | ||||||
| Mutagenesis | 162 | 1 | N → Q: Faster electrophoretic migration typical of a size reduction and important decrease of secretion. Larger size reduction; when associated with Q-178; Q-200; Q-217; Q-238 and Q-459. Ref.20 | ||||||
| Mutagenesis | 178 | 1 | N → Q: Faster electrophoretic migration typical of a size reduction and important decrease of secretion. Larger size reduction; when associated with Q-162; Q-200; Q-217; Q-238 and Q-459. Ref.20 | ||||||
| Mutagenesis | 200 | 1 | N → Q: Faster electrophoretic migration typical of a size reduction and partial decrease in secretion. Larger size reduction; when associated with Q-162; Q-178; Q-217; Q-238 and Q-459. Ref.20 | ||||||
| Mutagenesis | 217 | 1 | N → Q: Faster electrophoretic migration typical of a size reduction and partial decrease in secretion. Larger size reduction; when associated with Q-162; Q-178; Q-200; Q-238 and Q-459. Ref.20 | ||||||
| Mutagenesis | 225 | 1 | E → A: Loss of heparanase activity. No effect on HPSE-mediated cell adhesion. Ref.14 Ref.19 | ||||||
| Mutagenesis | 238 | 1 | N → Q: Faster electrophoretic migration typical of a size reduction. Larger size reduction and important decrease of secretion; when associated with Q-162; Q-178; Q-200; Q-217 and Q-459. Ref.20 | ||||||
| Mutagenesis | 343 | 1 | E → A: Loss of heparanase activity. Ref.14 | ||||||
| Mutagenesis | 367 | 1 | D → A: Strong decrease in heparanase activity. Ref.14 | ||||||
| Mutagenesis | 378 | 1 | E → A: No reduction in heparanase activity. | ||||||
| Mutagenesis | 396 | 1 | E → A: No reduction in heparanase activity. | ||||||
| Mutagenesis | 414 | 1 | V → K: Abolishes processing, secretion and enzyme activity. Ref.31 | ||||||
| Mutagenesis | 417 | 1 | K → E: No effect on processing nor secretion. No enzyme activity detected. Ref.31 | ||||||
| Mutagenesis | 459 | 1 | N → Q: Faster electrophoretic migration typical of a size reduction. Larger size reduction and important decrease of secretion; when associated with Q-162; Q-178; Q-200; Q-217 and Q-238. Ref.20 | ||||||
| Mutagenesis | 525 | 1 | P → G: No effect on processing nor secretion. No enzyme activity detected. Ref.31 | ||||||
| Mutagenesis | 527 | 1 | F → R: No effect on processing nor secretion. No enzyme activity detected. Ref.31 | ||||||
| Mutagenesis | 528 | 1 | S → K: No effect on processing nor secretion. No enzyme activity detected. Ref.31 | ||||||
| Mutagenesis | 529 | 1 | Y → A: No effect on processing nor secretion. No enzyme activity detected. Ref.31 | ||||||
| Mutagenesis | 531 | 1 | F → R: Abolishes processing, secretion and enzyme activity. Ref.31 | ||||||
| Mutagenesis | 533 | 1 | V → R: Abolishes processing, secretion and enzyme activity. Ref.31 | ||||||
| Mutagenesis | 534 | 1 | I → D: Abolishes processing, secretion and enzyme activity. Ref.31 | ||||||
| Mutagenesis | 535 | 1 | R → A: No effect on processing, secretion nor enzyme activity. Ref.31 | ||||||
| Mutagenesis | 536 | 1 | N → A: No effect on processing, secretion nor enzyme activity. Ref.31 | ||||||
| Mutagenesis | 537 | 1 | A → K: Abolishes processing, secretion and enzyme activity. Ref.31 | ||||||
| Mutagenesis | 538 | 1 | K → A: No effect on processing, secretion nor enzyme activity. Ref.31 | ||||||
| Mutagenesis | 539 | 1 | V → A: No effect on processing, secretion nor enzyme activity. Ref.31 | ||||||
| Mutagenesis | 540 | 1 | A → K: No effect on processing, secretion nor enzyme activity. Ref.31 | ||||||
| Mutagenesis | 541 | 1 | A → K: No effect on processing, secretion nor enzyme activity. Ref.31 | ||||||
| Mutagenesis | 542 | 1 | C → A: Abolishes processing, secretion and enzyme activity. Ref.31 | ||||||
| Sequence conflict | 13 | 1 | L → LL in AAD54516. Ref.5 | ||||||
| Sequence conflict | 36 | 1 | Q → QQ in AAD54516. Ref.5 | ||||||
| Sequence conflict | 291 | 1 | D → G in BAD96706. Ref.11 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and functional expression of a human heparanase gene." Kussie P.H., Hulmes J.D., Ludwig D.L., Patel S., Navarro E.C., Seddon A.P., Giorgio N.A., Bohlen P. Biochem. Biophys. Res. Commun. 261:183-187(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-307, TISSUE SPECIFICITY. Tissue: Placenta. |
| [2] | "Human heparanase. Purification, characterization, cloning, and expression." Toyoshima M., Nakajima M. J. Biol. Chem. 274:24153-24160(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), BIOPHYSICOCHEMICAL PROPERTIES, PROTEIN SEQUENCE OF 158-168; 326-337 AND 447-491, VARIANT ARG-307. Tissue: Embryonic fibroblast. |
| [3] | "Mammalian heparanase: gene cloning, expression and function in tumor progression and metastasis." Vlodavsky I., Friedmann Y., Elkin M., Aingorn H., Atzmon R., Ishai-Michaeli R., Bitan M., Pappo O., Peretz T., Michal I., Spector L., Pecker I. Nat. Med. 5:793-802(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), GLYCOSYLATION, PROTEOLYTIC PROCESSING, VARIANT ARG-307. |
| [4] | "Cloning of mammalian heparanase, an important enzyme in tumor invasion and metastasis." Hulett M.D., Freeman C., Hamdorf B.J., Baker R.T., Harris M.J., Parish C.R. Nat. Med. 5:803-809(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, PROTEIN SEQUENCE OF 158-174; 263-272; 326-337; 433-436; 438-443; 466-468 AND 478-483, VARIANT ARG-307. Tissue: Placenta. |
| [5] | "Heparanase expression in invasive trophoblasts and acute vascular damage." Dempsey L.A., Plummer T.B., Coombes S.L., Platt J.L. Glycobiology 10:467-475(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), BIOPHYSICOCHEMICAL PROPERTIES, TISSUE SPECIFICITY, VARIANT ARG-307. Tissue: Placenta. |
| [6] | "Molecular properties and involvement of heparanase in cancer progression and mammary gland morphogenesis." Zcharia E., Metzger S., Chajek-Shaul T., Friedmann Y., Pappo O., Aviv A., Elkin M., Pecker I., Peretz T., Vlodavsky I. J. Mammary Gland Biol. Neoplasia 6:311-322(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION. |
| [7] | "Biochemical characterization of the active heterodimer form of human heparanase (Hpa1) protein expressed in insect cells." McKenzie E., Young K., Hircock M., Bennett J., Bhaman M., Felix R., Turner P., Stamps A., McMillan D., Saville G., Ng S., Mason S., Snell D., Schofield D., Gong H., Townsend R., Gallagher J., Page M., Parekh R., Stubberfield C. Biochem. J. 373:423-435(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 36-41 AND 158-163, SUBUNIT, GLYCOSYLATION, BIOPHYSICOCHEMICAL PROPERTIES. Tissue: Placenta. |
| [8] | "Cloning, expression, and characterization of an alternatively spliced variant of human heparanase." Nasser N.J., Avivi A., Shushy M., Vlodavsky I., Nevo E. Biochem. Biophys. Res. Commun. 354:33-38(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING, VARIANT ARG-307. Tissue: Kidney. |
| [9] | "Cloned heparanase from MCF-7 cells." Pinhal M.A., Semedo P. Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-307. |
| [10] | "Two new transcript variants of Homo sapiens heparanase (HPSE)." Jin S., Yu L., Gong F. Submitted (JUN-2009) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANT ARG-307. |
| [11] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ARG-307. Tissue: Small intestine. |
| [12] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [13] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ARG-307. Tissue: Pancreas. |
| [14] | "Identification of active-site residues of the pro-metastatic endoglycosidase heparanase." Hulett M.D., Hornby J.R., Ohms S.J., Zuegg J., Freeman C., Gready J.E., Parish C.R. Biochemistry 39:15659-15667(2000) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF GLU-225; GLU-343 AND ASP-367. |
| [15] | "Human heparanase is localized within lysosomes in a stable form." Goldshmidt O., Nadav L., Aingorn H., Irit C., Feinstein N., Ilan N., Zamir E., Geiger B., Vlodavsky I., Katz B.Z. Exp. Cell Res. 281:50-62(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, PROTEOLYTIC PROCESSING, INTERACTION WITH SDC1. |
| [16] | "Structural recognition by recombinant human heparanase that plays critical roles in tumor metastasis. Hierarchical sulfate groups with different effects and the essential target disulfated trisaccharide sequence." Okada Y., Yamada S., Toyoshima M., Dong J., Nakajima M., Sugahara K. J. Biol. Chem. 277:42488-42495(2002) [PubMed] [Europe PMC] [Abstract] Cited for: CATALYTIC ACTIVITY, FUNCTION. |
| [17] | "Activation, processing and trafficking of extracellular heparanase by primary human fibroblasts." Nadav L., Eldor A., Yacoby-Zeevi O., Zamir E., Pecker I., Ilan N., Geiger B., Vlodavsky I., Katz B.Z. J. Cell Sci. 115:2179-2187(2002) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEOLYTIC PROCESSING, ENZYME ACTIVITY, SUBCELLULAR LOCATION. |
| [18] | "Heterodimer formation is essential for heparanase enzymatic activity." Levy-Adam F., Miao H.Q., Heinrikson R.L., Vlodavsky I., Ilan N. Biochem. Biophys. Res. Commun. 308:885-891(2003) [PubMed] [Europe PMC] [Abstract] Cited for: HETERODIMERIZATION, ENZYME ACTIVITY. |
| [19] | "Heparanase mediates cell adhesion independent of its enzymatic activity." Goldshmidt O., Zcharia E., Cohen M., Aingorn H., Cohen I., Nadav L., Katz B.Z., Geiger B., Vlodavsky I. FASEB J. 17:1015-1025(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF GLU-225. |
| [20] | "Secretion of heparanase protein is regulated by glycosylation in human tumor cell lines." Simizu S., Ishida K., Wierzba M.K., Osada H. J. Biol. Chem. 279:2697-2703(2004) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT ASN-162; ASN-178; ASN-200; ASN-217; ASN-238 AND ASN-459, MUTAGENESIS OF ASN-162; ASN-178; ASN-200; ASN-217; ASN-238 AND ASN-459. |
| [21] | "Heparanase induces endothelial cell migration via protein kinase B/Akt activation." Gingis-Velitski S., Zetser A., Flugelman M.Y., Vlodavsky I., Ilan N. J. Biol. Chem. 279:23536-23541(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [22] | "Heparanase uptake is mediated by cell membrane heparan sulfate proteoglycans." Gingis-Velitski S., Zetser A., Kaplan V., Ben-Zaken O., Cohen E., Levy-Adam F., Bashenko Y., Flugelman M.Y., Vlodavsky I., Ilan N. J. Biol. Chem. 279:44084-44092(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [23] | "Processing and activation of latent heparanase occurs in lysosomes." Zetser A., Levy-Adam F., Kaplan V., Gingis-Velitski S., Bashenko Y., Schubert S., Flugelman M.Y., Vlodavsky I., Ilan N. J. Cell Sci. 117:2249-2258(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEOLYTIC PROCESSING, SUBCELLULAR LOCATION. |
| [24] | "Heparanase processing by lysosomal/endosomal protein preparation." Cohen E., Atzmon R., Vlodavsky I., Ilan N. FEBS Lett. 579:2334-2338(2005) [PubMed] [Europe PMC] [Abstract] Cited for: BIOPHYSICOCHEMICAL PROPERTIES, PROTEOLYTIC PROCESSING, SUBCELLULAR LOCATION. |
| [25] | "Site-directed mutagenesis, proteolytic cleavage, and activation of human proheparanase." Abboud-Jarrous G., Rangini-Guetta Z., Aingorn H., Atzmon R., Elgavish S., Peretz T., Vlodavsky I. J. Biol. Chem. 280:13568-13575(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, PROTEOLYTIC PROCESSING, MUTAGENESIS OF TYR-156. |
| [26] | "Identification and characterization of heparin/heparan sulfate binding domains of the endoglycosidase heparanase." Levy-Adam F., Abboud-Jarrous G., Guerrini M., Beccati D., Vlodavsky I., Ilan N. J. Biol. Chem. 280:20457-20466(2005) [PubMed] [Europe PMC] [Abstract] Cited for: HEPARIN/HS-BINDING DOMAINS, MUTAGENESIS OF LYS-158 AND LYS-161. |
| [27] | "Heparanase induces vascular endothelial growth factor expression: correlation with p38 phosphorylation levels and Src activation." Zetser A., Bashenko Y., Edovitsky E., Levy-Adam F., Vlodavsky I., Ilan N. Cancer Res. 66:1455-1463(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [28] | "Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach." Lewandrowski U., Moebius J., Walter U., Sickmann A. Mol. Cell. Proteomics 5:226-233(2006) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-217, MASS SPECTROMETRY. Tissue: Platelet. |
| [29] | "Heparanase 1: a key participant of inner root sheath differentiation program and hair follicle homeostasis." Malgouries S., Donovan M., Thibaut S., Bernard B.A. Exp. Dermatol. 17:1017-1023(2008) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, FUNCTION. |
| [30] | "Heparanase induces VEGF C and facilitates tumor lymphangiogenesis." Cohen-Kaplan V., Naroditsky I., Zetser A., Ilan N., Vlodavsky I., Doweck I. Int. J. Cancer 123:2566-2573(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [31] | "Structure-function approach identifies a COOH-terminal domain that mediates heparanase signaling." Fux L., Feibish N., Cohen-Kaplan V., Gingis-Velitski S., Feld S., Geffen C., Vlodavsky I., Ilan N. Cancer Res. 69:1758-1767(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION OF THE C-TERMINAL DOMAIN, SUBCELLULAR LOCATION, MUTAGENESIS OF VAL-414; LYS-417; PRO-525; PHE-527; SER-528; TYR-529; PHE-531; VAL-533; ILE-534; ARG-535; ASN-536; ALA-537; LYS-538; VAL-539; ALA-540; ALA-541 AND CYS-542. |
| [32] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-217 AND ASN-238, MASS SPECTROMETRY. Tissue: Liver. |
| [33] | "Heparanase-enhanced shedding of syndecan-1 by myeloma cells promotes endothelial invasion and angiogenesis." Purushothaman A., Uyama T., Kobayashi F., Yamada S., Sugahara K., Rapraeger A.C., Sanderson R.D. Blood 115:2449-2457(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [34] | "Heparanase enhances the generation of activated factor X in the presence of tissue factor and activated factor VII." Nadir Y., Brenner B., Fux L., Shafat I., Attias J., Vlodavsky I. Haematologica 95:1927-1934(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TF, ENZYME ACTIVITY. |
| [35] | "Histidine-rich glycoprotein binds heparanase and regulates its enzymatic activity and cell surface interactions." Poon I.K., Yee D.Y., Jones A.L., Wood R.J., Davis D.S., Freeman C., Parish C.R., Hulett M.D. Int. J. Biochem. Cell Biol. 42:1507-1516(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HRG, ENZYME ACTIVITY, FUNCTION. |
| [36] | "Unraveling the specificity of heparanase utilizing synthetic substrates." Peterson S.B., Liu J. J. Biol. Chem. 285:14504-14513(2010) [PubMed] [Europe PMC] [Abstract] Cited for: CATALYTIC ACTIVITY, FUNCTION. |
| [37] | "Heparanase 2 interacts with heparan sulfate with high affinity and inhibits heparanase activity." Levy-Adam F., Feld S., Cohen-Kaplan V., Shteingauz A., Gross M., Arvatz G., Naroditsky I., Ilan N., Doweck I., Vlodavsky I. J. Biol. Chem. 285:28010-28019(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HPSE2. |
| [38] | "Heparanase in primary human osteoblasts." Smith P.N., Freeman C., Yu D., Chen M., Gatenby P.A., Parish C.R., Li R.W. J. Orthop. Res. 28:1315-1322(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| [39] | "Heparanase plays a dual role in driving hepatocyte growth factor (HGF) signaling by enhancing HGF expression and activity." Ramani V.C., Yang Y., Ren Y., Nan L., Sanderson R.D. J. Biol. Chem. 286:6490-6499(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [40] | "Heparanase mRNA expression and point mutation in hepatocellular carcinoma." Chen X.P., Liu Y.B., Rui J., Peng S.Y., Peng C.H., Zhou Z.Y., Shi L.H., Shen H.W., Xu B. World J. Gastroenterol. 10:2795-2799(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SER-260. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF152376 mRNA. Translation: AAD45669.1. AF155510 mRNA. Translation: AAD54941.1. AF144325 mRNA. Translation: AAD41342.1. AF165154 mRNA. Translation: AAD45379.1. AF084467 mRNA. Translation: AAD54516.1. AM419200 mRNA. Translation: CAL91960.1. AY948074 mRNA. Translation: AAX47106.1. GQ337901 mRNA. Translation: ACT98237.1. AK222986 mRNA. Translation: BAD96706.1. AC114781 Genomic DNA. No translation available. BC051321 mRNA. Translation: AAH51321.1. |
| IPI | IPI00410297. IPI00884403. IPI00944522. |
| RefSeq | NP_001092010.1. NM_001098540.2. NP_001159970.1. NM_001166498.2. NP_001186759.1. NM_001199830.1. NP_006656.2. NM_006665.5. |
| UniGene | Hs.44227. |
3D structure databases | |
| ProteinModelPortal | Q9Y251. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000308107. |
Protein family/group databases | |
| CAZy | GH79. Glycoside Hydrolase Family 79. |
PTM databases | |
| PhosphoSite | Q9Y251. |
Polymorphism databases | |
| DMDM | 296434532. |
Proteomic databases | |
| PaxDb | Q9Y251. |
| PRIDE | Q9Y251. |
Protocols and materials databases | |
| DNASU | 10855. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000311412; ENSP00000308107; ENSG00000173083. ENST00000405413; ENSP00000384262; ENSG00000173083. ENST00000512196; ENSP00000423265; ENSG00000173083. ENST00000513463; ENSP00000421365; ENSG00000173083. |
| GeneID | 10855. |
| KEGG | hsa:10855. |
| UCSC | uc003hoj.4. human. |
Organism-specific databases | |
| CTD | 10855. |
| GeneCards | GC04M084213. |
| HGNC | HGNC:5164. HPSE. |
| HPA | CAB009813. |
| MIM | 604724. gene. |
| neXtProt | NX_Q9Y251. |
| PharmGKB | PA29435. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG72789. |
| HOGENOM | HOG000007256. |
| HOVERGEN | HBG081606. |
| InParanoid | Q9Y251. |
| KO | K07964. |
| OMA | TWHHYYL. |
| OrthoDB | EOG45MN5C. |
| PhylomeDB | Q9Y251. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:ENSG00000173083-MONOMER. |
| Pathway_Interaction_DB | syndecan_1_pathway. Syndecan-1-mediated signaling events. |
| Reactome | REACT_111217. Metabolism. REACT_116125. Disease. |
Gene expression databases | |
| ArrayExpress | Q9Y251. |
| Bgee | Q9Y251. |
| CleanEx | HS_HPSE. |
| Genevestigator | Q9Y251. |
| GermOnline | ENSG00000173083. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.20.20.80. 1 hit. |
| InterPro | IPR005199. Glyco_hydro_79. IPR013781. Glyco_hydro_catalytic_dom. IPR017853. Glycoside_hydrolase_SF. [Graphical view] |
| PANTHER | PTHR14363. PTHR14363. 1 hit. |
| Pfam | PF03662. Glyco_hydro_79n. 1 hit. [Graphical view] |
| SUPFAM | SSF51445. Glyco_hydro_cat. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL3921. |
| DrugBank | DB01109. Heparin. |
| GenomeRNAi | 10855. |
| NextBio | 41205. |
| SOURCE | Search... |
Entry information
| Entry name | HPSE_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y251 Secondary accession number(s): A9JIG7 Q9UL39 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Glycosyl hydrolases Classification of glycosyl hydrolase families and list of entries |
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
