Q9Y223 (GLCNE_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase Alternative name(s): UDP-GlcNAc-2-epimerase/ManAc kinase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 722 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Regulates and initiates biosynthesis of N-acetylneuraminic acid (NeuAc), a precursor of sialic acids. Plays an essential role in early development By similarity. Required for normal sialylation in hematopoietic cells. Sialylation is implicated in cell adhesion, signal transduction, tumorigenicity and metastatic behavior of malignant cells. Ref.12 |
| Catalytic activity | UDP-N-acetyl-alpha-D-glucosamine + H2O = N-acetyl-D-mannosamine + UDP. ATP + N-acyl-D-mannosamine = ADP + N-acyl-D-mannosamine 6-phosphate. |
| Enzyme regulation | Allosterically regulated Probable; feedback inhibited by cytidine monophosphate-N-acetylneuraminic acid (CMP-Neu5Ac), the end product of neuraminic acid biosynthesis. Activity is dependent on oligomerization. The monomer is inactive, whereas the dimer catalyzes only the phosphorylation of N-acetylmannosamine; the hexamer is fully active for both enzyme activities By similarity. Up-regulated after PKC-dependent phosphorylation. Ref.11 |
| Pathway | |
| Subunit structure | |
| Subcellular location | Cytoplasm By similarity. |
| Tissue specificity | Highest expression in liver and placenta. Also found in heart, brain, lung, kidney, skeletal muscle and pancreas. Isoform 1 is expressed in heart, brain, kidney, liver, placenta, lung, spleen, pancreas, skeletal muscle and colon. Isoform 2 is expressed mainly in placenta, but also in brain, kidney, liver, lung, pancreas and colon. Isoform 3 is expressed at low level in kidney, liver, placenta and colon. Ref.1 Ref.2 Ref.7 |
| Post-translational modification | Phosphorylated by PKC By similarity. |
| Involvement in disease | Sialuria (SIALURIA) [MIM:269921]: In sialuria, free sialic acid accumulates in the cytoplasm and gram quantities of neuraminic acid are secreted in the urine. The metabolic defect involves lack of feedback inhibition of UDP-GlcNAc 2-epimerase by CMP-Neu5Ac, resulting in constitutive overproduction of free Neu5Ac. Clinical features include variable degrees of developmental delay, coarse facial features and hepatomegaly. Sialuria inheritance is autosomal dominant. Inclusion body myopathy 2 (IBM2) [MIM:600737]: Hereditary inclusion body myopathies are a group of neuromuscular disorders characterized by adult onset, slowly progressive distal and proximal weakness and a typical muscle pathology including rimmed vacuoles and filamentous inclusions. IBM2 is an autosomal recessive disorder affecting mainly leg muscles, but with an unusual distribution that spares the quadriceps as also observed in Nonaka myopathy. Nonaka myopathy (NM) [MIM:605820]: Autosomal recessive muscular disorder, allelic to inclusion body myopathy 2. It is characterized by weakness of the anterior compartment of the lower limbs with onset in early adulthood, and sparing of the quadriceps muscles. As the inclusion body myopathy, NM is histologically characterized by the presence of numerous rimmed vacuoles without inflammatory changes in muscle specimens. |
| Sequence similarities | In the N-terminal section; belongs to the UDP-N-acetylglucosamine 2-epimerase family. In the C-terminal section; belongs to the ROK (NagC/XylR) family. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y223-1) Also known as: GNE1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y223-2) Also known as: GNE2; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → METYGYLQRESCFQGPHELYFKNLSKRNKQIM | ||||||
| Isoform 3 (identifier: Q9Y223-3) Also known as: GNE3; The sequence of this isoform differs from the canonical sequence as follows: 1-55: MEKNGNNRKLRVCVATCNRADYSKLAPIMFGIKTEPEFFELDVVVLGSHLIDDYG → MVICRGSHAFKDLI | ||||||
| Isoform 4 (identifier: Q9Y223-4) The sequence of this isoform differs from the canonical sequence as follows: 471-544: Missing. | ||||||
| Isoform 5 (identifier: Q9Y223-5) The sequence of this isoform differs from the canonical sequence as follows: 1-59: Missing. 206-256: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 722 | 722 | Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase | PRO_0000095716 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 411 – 420 | 10 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 543 – 552 | 10 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1 – ? | UDP-N-acetylglucosamine 2-epimerase | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 406 – 722 | 317 | N-acetylmannosamine kinase | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 517 | 1 | Ref.15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 569 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 579 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 581 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 586 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 477 | 1 | Substrate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 489 | 1 | Substrate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 517 | 1 | Substrate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 566 | 1 | Substrate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 569 | 1 | Substrate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 588 | 1 | Substrate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 59 | 59 | Missing in isoform 5. | VSP_043975 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 55 | 55 | MEKNG…IDDYG → MVICRGSHAFKDLI in isoform 3. | VSP_041028 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → METYGYLQRESCFQGPHELY FKNLSKRNKQIM in isoform 2. | VSP_041027 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 206 – 256 | 51 | Missing in isoform 5. | VSP_043976 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 471 – 544 | 74 | Missing in isoform 4. | VSP_043474 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 27 | 1 | P → S in IBM2. Ref.29 | VAR_021771 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 36 | 1 | P → L in IBM2. Ref.26 | VAR_017945 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 132 | 1 | H → Q in NM. Ref.23 | VAR_021772 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 162 | 1 | R → C in IBM2. Ref.27 | VAR_021773 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 171 | 1 | M → V in IBM2. Ref.25 | VAR_021774 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 176 | 1 | D → V in NM. Ref.23 | VAR_021775 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 177 | 1 | R → C in NM. Ref.23 | VAR_021776 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 200 | 1 | I → F in IBM2. Ref.26 | VAR_017946 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 206 | 1 | G → S in IBM2; moderate phenotype with unusual involvement of quadriceps. Ref.29 | VAR_021777 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 216 | 1 | V → A in IBM2. Ref.24 | VAR_021778 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 225 | 1 | D → N in IBM2. Ref.18 Ref.21 Ref.26 | VAR_017947 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 246 | 1 | R → Q in IBM2. Ref.18 Ref.21 Ref.26 Ref.29 | VAR_017948 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 246 | 1 | R → W in IBM2. Ref.21 | VAR_017949 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 263 | 1 | R → L in SIALURIA; strong reduction of feedback inhibition by CMP-Neu5Ac. Ref.2 | VAR_017950 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 266 | 1 | R → Q in SIALURIA; abolishes feedback inhibition by CMP-Neu5Ac. Ref.2 Ref.16 Ref.17 | VAR_017951 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 266 | 1 | R → W in sialuria. Ref.2 | VAR_017952 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 303 | 1 | C → V in IBM2; requires 2 nucleotide substitutions. Ref.26 | VAR_017953 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 306 | 1 | R → Q in NM. Ref.23 | VAR_021779 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 331 | 1 | V → A in NM. Ref.23 | VAR_021780 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 378 | 1 | D → Y in IBM2 and NM. Ref.23 Ref.26 | VAR_017954 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 460 | 1 | A → V in NM and IBM2. Ref.20 Ref.21 Ref.26 | VAR_017955 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 472 | 1 | I → T in NM. Ref.23 Ref.28 | VAR_021781 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 519 | 1 | N → S in IBM2. Ref.29 | VAR_021782 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 524 | 1 | A → V in IBM2. Ref.21 | VAR_017956 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 528 | 1 | F → C in IBM2. Ref.26 | VAR_017957 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 557 | 1 | I → T in IBM2. Ref.26 | VAR_017958 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 572 | 1 | V → L in NM and IBM2. Ref.19 Ref.20 Ref.21 Ref.22 Ref.23 Ref.26 Ref.28 | VAR_017959 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 576 | 1 | G → E in IBM2. Ref.18 Ref.21 Ref.26 | VAR_017960 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 587 | 1 | I → T in IBM2. Ref.26 | VAR_017961 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 600 | 1 | A → T in IBM2. Ref.29 | VAR_021783 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 630 | 1 | A → T in NM. Ref.23 | VAR_021784 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 631 | 1 | A → T in IBM2. Ref.18 Ref.21 Ref.26 | VAR_017962 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 631 | 1 | A → V in NM and IBM2. Ref.22 Ref.23 Ref.24 Ref.26 | VAR_017963 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 675 | 1 | Y → H in IBM2. Ref.21 | VAR_017964 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 696 | 1 | V → M in IBM2. Ref.18 Ref.21 Ref.26 | VAR_017965 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 712 | 1 | M → T in IBM2. Ref.18 Ref.21 Ref.25 Ref.26 Corresponds to variant rs28937594 [ dbSNP | Ensembl ]. | VAR_017966 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 338 | 1 | D → G in BAH12108. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 364 | 1 | G → V in BAH12108. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 382 | 1 | P → L in BAH12108. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 498 | 1 | V → A in BAH12108. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 406 – 414 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 416 – 425 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 430 – 437 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 442 – 462 | 21 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 465 – 479 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 480 – 483 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 484 – 487 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 492 – 494 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 496 – 499 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 501 – 508 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 512 – 516 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 517 – 527 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 530 – 533 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 537 – 552 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 567 – 569 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 571 – 574 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 584 – 586 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 587 – 591 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 593 – 605 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 624 – 632 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 636 – 659 | 24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 663 – 669 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 672 – 686 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 689 – 691 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 695 – 698 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 704 – 716 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Primary structure and expression analysis of human UDP-N-acetyl-glucosamine-2-epimerase/N-acetylmannosamine kinase, the bifunctional enzyme in neuraminic acid biosynthesis." Lucka L., Krause M., Danker K., Reutter W., Horstkorte R. FEBS Lett. 454:341-344(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Liver. |
| [2] | "Mutations in the human UDP-N-acetylglucosamine 2-epimerase gene define the disease sialuria and the allosteric site of the enzyme." Seppala R., Lehto V.-P., Gahl W.A. Am. J. Hum. Genet. 64:1563-1569(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANTS SIALURIA LEU-263; GLN-266 AND TRP-266. |
| [3] | Wang S.S., Ryll T. Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Small intestine. |
| [4] | "Organization of the human UDP-N-acetylglucosamine 2-epimerase gene and characterization of a related pseudogene; relevance for mutation detection in patients with sialuria." Huizing M., Anikster Y., Gahl W.A. Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [5] | "mRNA analysis revealed splice mutation and expression alteration of GNE gene in distal myopathy with rimmed vacuoles (DMRV) patients." Pramono Z.A.D., Lai P.S., Seah I.A.L., Ong B., Yee W.C. Submitted (AUG-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5). Tissue: Hippocampus and Tongue. |
| [7] | "Prediction of three different isoforms of the human UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase." Reinke S.O., Hinderlich S. FEBS Lett. 581:3327-3331(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), TISSUE SPECIFICITY. |
| [8] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [11] | "Identification of the metabolic defect in sialuria." Weiss P., Tietze F., Gahl W.A., Seppala R., Ashwell G. J. Biol. Chem. 264:17635-17636(1989) [PubMed] [Europe PMC] [Abstract] Cited for: ENZYME REGULATION, INVOLVEMENT IN SIALURIA. |
| [12] | "UDP-GlcNAc 2-epimerase: a regulator of cell surface sialylation." Keppler O.T., Hinderlich S., Langner J., Schwartz-Albiez R., Reutter W., Pawlita M. Science 284:1372-1376(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [14] | "Crystal structure of the N-acetylmannosamine kinase domain of GNE." Tong Y., Tempel W., Nedyalkova L., Mackenzie F., Park H.W. PLoS ONE 4:E7165-E7165(2009) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.84 ANGSTROMS) OF 406-720, SUBUNIT. |
| [15] | "Crystal structures of N-acetylmannosamine kinase provide insights into enzyme activity and inhibition." Martinez J., Nguyen L.D., Hinderlich S., Zimmer R., Tauberger E., Reutter W., Saenger W., Fan H., Moniot S. J. Biol. Chem. 287:13656-13665(2012) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.64 ANGSTROMS) OF 406-720 IN COMPLEX WITH ADP AND N-ACETYLMANNOSAMINE, ZINC-BINDING SITES, ACTIVE SITE, SUBUNIT. |
| [16] | "Sialuria in a Portuguese girl: clinical, biochemical, and molecular characteristics." Ferreira H., Seppala R., Pinto R., Huizing M., Martins E., Braga A.C., Gomes L., Krasnewich D.M., Sa Miranda M.C., Gahl W.A. Mol. Genet. Metab. 67:131-137(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SIALURIA GLN-266. |
| [17] | "Dominant inheritance of sialuria, an inborn error of feedback inhibition." Leroy J.G., Seppala R., Huizing M., Dacremont G., De Simpel H., Van Coster R.N., Orvisky E., Krasnewich D.M., Gahl W.A. Am. J. Hum. Genet. 68:1419-1427(2001) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION OF VARIANT SIALURIA GLN-266. |
| [18] | "The UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase gene is mutated in recessive hereditary inclusion body myopathy." Eisenberg I., Avidan N., Potikha T., Hochner H., Chen M., Olender T., Barash M., Shemesh M., Sadeh M., Grabov-Nardini G., Shmilevich I., Friedmann A., Karpati G., Bradley W.G., Baumbach L., Lancet D., Asher E.B., Beckmann J.S., Argov Z., Mitrani-Rosenbaum S. Nat. Genet. 29:83-87(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS IBM2 ASN-225; GLN-246; GLU-576; THR-631; MET-696 AND THR-712. |
| [19] | "A novel mutation in the GNE gene and a linkage disequilibrium in Japanese pedigrees." Arai A., Tanaka K., Ikeuchi T., Igarashi S., Kobayashi H., Asaka T., Date H., Saito M., Tanaka H., Kawasaki S., Uyama E., Mizusawa H., Fukuhara N., Tsuji S. Ann. Neurol. 52:516-519(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT NM LEU-572. |
| [20] | "Nonaka myopathy is caused by mutations in the UDP-N-acetylglucosamine-2-epimerase/N-acetylmannosamine kinase gene (GNE)." Kayashima T., Matsuo H., Satoh A., Ohta T., Yoshiura K., Matsumoto N., Nakane Y., Niikawa N., Kishino T. J. Hum. Genet. 47:77-79(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS NM VAL-460 AND LEU-572. |
| [21] | "Four novel mutations associated with autosomal recessive inclusion body myopathy (MIM: 600737)." Darvish D., Vahedifar P., Huo Y. Mol. Genet. Metab. 77:252-256(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS IBM2 ASN-225; GLN-246; TRP-246; VAL-460; VAL-524; LEU-572; GLU-576; THR-631; HIS-675; MET-696 AND THR-712. |
| [22] | "Distal myopathy with rimmed vacuoles: novel mutations in the GNE gene." Tomimitsu H., Ishikawa K., Shimizu J., Ohkoshi N., Kanazawa I., Mizusawa H. Neurology 59:451-454(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS NM LEU-572 AND VAL-631. |
| [23] | "Distal myopathy with rimmed vacuoles is allelic to hereditary inclusion body myopathy." Nishino I., Noguchi S., Murayama K., Driss A., Sugie K., Oya Y., Nagata T., Chida K., Takahashi T., Takusa Y., Ohi T., Nishimiya J., Sunohara N., Ciafaloni E., Kawai M., Aoki M., Nonaka I. Neurology 59:1689-1693(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS NM GLN-132; VAL-176; CYS-177; GLN-306; ALA-331; TYR-378; THR-472; LEU-572; THR-630 AND VAL-631. |
| [24] | "GNE mutations in an American family with quadriceps-sparing IBM and lack of mutations in s-IBM." Vasconcelos O.M., Raju R., Dalakas M.C. Neurology 59:1776-1779(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS IBM2 ALA-216 AND VAL-631. |
| [25] | "An Italian family with autosomal recessive inclusion-body myopathy and mutations in the GNE gene." Broccolini A., Pescatori M., D'Amico A., Sabino A., Silvestri G., Ricci E., Servidei S., Tonali P.A., Mirabella M. Neurology 59:1808-1809(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS IBM2 VAL-171 AND THR-712. |
| [26] | "Mutations spectrum of GNE in hereditary inclusion body myopathy sparing the quadriceps." Eisenberg I., Grabov-Nardini G., Hochner H., Korner M., Sadeh M., Bertorini T., Bushby K., Castellan C., Felice K., Mendell J., Merlini L., Shilling C., Wirguin I., Argov Z., Mitrani-Rosenbaum S. Hum. Mutat. 21:99-99(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS IBM2 LEU-36; PHE-200; ASN-225; GLN-246; VAL-303; TYR-378; VAL-460; CYS-528; THR-557; LEU-572; GLU-576; THR-587; THR-631; VAL-631; MET-696 AND THR-712. |
| [27] | "Novel missense mutation and large deletion of GNE gene in autosomal-recessive inclusion-body myopathy." Del Bo R., Baron P., Prelle A., Serafini M., Moggio M., Di Fonzo A., Castagni M., Bresolin N., Comi G.P. Muscle Nerve 28:113-117(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT IBM2 CYS-162. |
| [28] | "GNE mutations causing distal myopathy with rimmed vacuoles with inflammation." Yabe I., Higashi T., Kikuchi S., Sasaki H., Fukazawa T., Yoshida K., Tashiro K. Neurology 61:384-386(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS NM THR-472 AND LEU-572. |
| [29] | "Novel GNE mutations in Italian families with autosomal recessive hereditary inclusion-body myopathy." Broccolini A., Ricci E., Cassandrini D., Gliubizzi C., Bruno C., Tonoli E., Silvestri G., Pescatori M., Rodolico C., Sinicropi S., Servidei S., Zara F., Minetti C., Tonali P.A., Mirabella M. Hum. Mutat. 23:632-632(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS IBM2 SER-27; SER-206; GLN-246; SER-519 AND THR-600. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AJ238764 mRNA. Translation: CAB42607.1. AF051852 mRNA. Translation: AAD32251.1. AF155663 mRNA. Translation: AAD38197.1. AF317635 Genomic DNA. Translation: AAG31661.1. EU093084 mRNA. Translation: ABU55403.1. AK295562 mRNA. Translation: BAH12108.1. AK312539 mRNA. Translation: BAG35438.1. AM697708 mRNA. Translation: CAM91424.1. AM697709 mRNA. Translation: CAM91425.1. AL158830 Genomic DNA. Translation: CAD13389.1. CH471071 Genomic DNA. Translation: EAW58307.1. CH471071 Genomic DNA. Translation: EAW58309.1. BC121179 mRNA. Translation: AAI21180.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00023162. IPI00867674. IPI00896504. IPI00922266. IPI00982551. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001121699.1. NM_001128227.2. NP_001177312.1. NM_001190383.1. NP_001177313.1. NM_001190384.1. NP_001177317.1. NM_001190388.1. NP_005467.1. NM_005476.5. | ||||||||||||||||||||||||||||||
| UniGene | Hs.5920. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9Y223. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000379839. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | Q9Y223. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 45476991. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | Q9Y223. | ||||||||||||||||||||||||||||||
| PeptideAtlas | Q9Y223. | ||||||||||||||||||||||||||||||
| PRIDE | Q9Y223. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| DNASU | 10020. | ||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000377902; ENSP00000367134; ENSG00000159921. ENST00000396594; ENSP00000379839; ENSG00000159921. ENST00000447283; ENSP00000414760; ENSG00000159921. ENST00000539208; ENSP00000445117; ENSG00000159921. ENST00000539815; ENSP00000439155; ENSG00000159921. | ||||||||||||||||||||||||||||||
| GeneID | 10020. | ||||||||||||||||||||||||||||||
| KEGG | hsa:10020. | ||||||||||||||||||||||||||||||
| UCSC | uc010mlh.3. human. uc010mli.3. human. uc010mlj.3. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 10020. | ||||||||||||||||||||||||||||||
| GeneCards | GC09M036204. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:23657. GNE. | ||||||||||||||||||||||||||||||
| HPA | HPA007045. HPA027258. | ||||||||||||||||||||||||||||||
| MIM | 269921. phenotype. 600737. phenotype. 603824. gene. 605820. phenotype. | ||||||||||||||||||||||||||||||
| neXtProt | NX_Q9Y223. | ||||||||||||||||||||||||||||||
| Orphanet | 602. Distal myopathy, Nonaka type. 3166. Sialuria, French type. | ||||||||||||||||||||||||||||||
| PharmGKB | PA134987566. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | COG0381. | ||||||||||||||||||||||||||||||
| HOGENOM | HOG000008254. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG051733. | ||||||||||||||||||||||||||||||
| InParanoid | Q9Y223. | ||||||||||||||||||||||||||||||
| KO | K12409. | ||||||||||||||||||||||||||||||
| OMA | LIQEWSS. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG4QFWCN. | ||||||||||||||||||||||||||||||
| PhylomeDB | Q9Y223. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| UniPathway | UPA00630. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | Q9Y223. | ||||||||||||||||||||||||||||||
| Bgee | Q9Y223. | ||||||||||||||||||||||||||||||
| CleanEx | HS_GNE. | ||||||||||||||||||||||||||||||
| Genevestigator | Q9Y223. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000159921. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR001312. Hexokinase. IPR000600. ROK. IPR020004. UDP-GlcNAc_Epase. IPR003331. UDP_GlcNAc_Epimerase_2. [Graphical view] | ||||||||||||||||||||||||||||||
| Pfam | PF02350. Epimerase_2. 1 hit. PF00480. ROK. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PRINTS | PR00475. HEXOKINASE. | ||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR03568. NeuC_NnaA. 1 hit. | ||||||||||||||||||||||||||||||
| PROSITE | PS01125. ROK. False negative. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| ChiTaRS | GNE. human. | ||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q9Y223. | ||||||||||||||||||||||||||||||
| GenomeRNAi | 10020. | ||||||||||||||||||||||||||||||
| NextBio | 37861. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | GLCNE_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y223 Secondary accession number(s): A6PZH2 Q0VA94 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
