SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9Y222

- DMTF1_HUMAN

UniProt

Q9Y222 - DMTF1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Cyclin-D-binding Myb-like transcription factor 1
Gene
DMTF1, DMP1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Transcriptional activator which activates the CDKN2A/ARF locus in response to Ras-Raf signaling, thereby promoting p53/TP53-dependent growth arrest By similarity. Binds to the consensus sequence 5'-CCCG[GT]ATGT-3' By similarity. Isoform 1 may cooperate with MYB to activate transcription of the ANPEP gene. Isoform 2 may antagonize transcriptional activation by isoform 1.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi306 – 32924H-T-H motif By similarity
Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. chromatin binding Source: InterPro
  3. sequence-specific DNA binding transcription factor activity Source: UniProtKB

GO - Biological processi

  1. cell cycle Source: UniProtKB-KW
  2. regulation of transcription, DNA-templated Source: UniProtKB
  3. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Cell cycle, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-D-binding Myb-like transcription factor 1
Short name:
hDMTF1
Alternative name(s):
Cyclin-D-interacting Myb-like protein 1
Short name:
hDMP1
Gene namesi
Name:DMTF1
Synonyms:DMP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:14603. DMTF1.

Subcellular locationi

Nucleus 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

PharmGKBiPA27389.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 760760Cyclin-D-binding Myb-like transcription factor 1
PRO_0000323729Add
BLAST

Post-translational modificationi

Phosphorylated by the cyclin-D2/CDK4, cyclin-D3/CDK4 and cyclin-D2/CDK6 complexes and to a lesser extent by the cyclin-D1/CDK4 complex By similarity.

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9Y222.
PaxDbiQ9Y222.
PRIDEiQ9Y222.

PTM databases

PhosphoSiteiQ9Y222.

Expressioni

Tissue specificityi

Expressed at relatively low levels in colonic mucosa, ovary, peripheral leukocytes, prostate and small intestine, and at higher levels in spleen, testis and thymus. Expressed in multiple regions of the brain and CNS including amygdala, caudate, corpus callosum, hippocampus, substantia nigra and subthalamic nucleus. Isoform 1 is the predominant isoform in monocytes, macrophages and neutrophils, isoform 2 is most strongly expressed in peripheral blood leukocytes and quiescent CD34 positive cells, and isoform 3 is expressed at low levels in all hematopoietic cell types. Expression is frequently reduced in non-small-cell lung carcinomas (NSCLC) due to hemizygous gene deletion, strongly suggesting that this locus is haploinsufficient for tumor suppression. Loss of this locus frequently occurs in tumors which retain wild-type CDKN2A/ARF and p53/TP53 loci. Hemizygous gene deletion has also been observed in leukemic blasts from patients with abnormalities of the long arm of chromosome 7.3 Publications

Developmental stagei

Isoform 2 expression is down-regulated during myeloid differentiation, while the expression of isoform 1 and isoform 3 remain constant.

Gene expression databases

ArrayExpressiQ9Y222.
BgeeiQ9Y222.
CleanExiHS_DMP1.
HS_DMTF1.
GenevestigatoriQ9Y222.

Organism-specific databases

HPAiHPA023846.

Interactioni

Subunit structurei

Interacts with the D-type cyclins CCND1, CCND2 and CCND3 By similarity. Interaction with D-type cyclins may modulate transcriptional activation by this protein By similarity.

Protein-protein interaction databases

BioGridi115309. 2 interactions.
IntActiQ9Y222. 3 interactions.
MINTiMINT-1196157.
STRINGi9606.ENSP00000332171.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi229 – 24214
Helixi246 – 2538
Helixi257 – 26610

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2LLKNMR-A220-274[»]
ProteinModelPortaliQ9Y222.
SMRiQ9Y222. Positions 220-344.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini225 – 26339Myb-like 1
Add
BLAST
Domaini268 – 33366HTH myb-type
Add
BLAST
Domaini339 – 38850Myb-like 2
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 237237Interaction with CCND2 By similarity
Add
BLAST
Regioni87 – 458372Required for DNA-binding By similarity
Add
BLAST
Regioni87 – 17084Required for transcriptional activation By similarity
Add
BLAST
Regioni176 – 760585Interaction with CCND1, CCND2 and CCND3 By similarity
Add
BLAST
Regioni459 – 760302Required for transcriptional activation By similarity
Add
BLAST

Sequence similaritiesi

Belongs to the DMTF1 family.
Contains 2 Myb-like domains.

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG288590.
HOVERGENiHBG053416.
InParanoidiQ9Y222.
OMAiTDPILQH.
OrthoDBiEOG7QZG92.
PhylomeDBiQ9Y222.
TreeFamiTF333537.

Family and domain databases

Gene3Di1.10.10.60. 2 hits.
InterProiIPR009057. Homeodomain-like.
IPR017877. Myb-like_dom.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
[Graphical view]
PfamiPF00249. Myb_DNA-binding. 2 hits.
[Graphical view]
SMARTiSM00717. SANT. 3 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 3 hits.
PROSITEiPS51294. HTH_MYB. 1 hit.
PS50090. MYB_LIKE. 2 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9Y222-1) [UniParc]FASTAAdd to Basket

Also known as: Alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSTVEEDSDT VTVETVNSVT LTQDTEGNLI LHCPQNEADE IDSEDSIEPP    50
HKRLCLSSED DQSIDDSTPC ISVVALPLSE NDQSFEVTMT ATTEVADDEV 100
TEGTVTQIQI LQNEQLDEIS PLGNEEVSAV SQAWFTTKED KDSLTNKGHK 150
WKQGMWSKEE IDILMNNIER YLKARGIKDA TEIIFEMSKD ERKDFYRTIA 200
WGLNRPLFAV YRRVLRMYDD RNHVGKYTPE EIEKLKELRI KHGNDWATIG 250
AALGRSASSV KDRCRLMKDT CNTGKWTEEE EKRLAEVVHE LTSTEPGDIV 300
TQGVSWAAVA ERVGTRSEKQ CRSKWLNYLN WKQSGGTEWT KEDEINLILR 350
IAELDVADEN DINWDLLAEG WSSVRSPQWL RSKWWTIKRQ IANHKDVSFP 400
VLIKGLKQLH ENQKNNPTLL ENKSGSGVPN SNTNSSVQHV QIRVARLEDN 450
TAISSSPMAA LQIPVQITHV SSADSPATVD SETITLNSGT LQTFEILPSF 500
HLQPTGTPGT YLLQTSSSQG LPLTLTASPT VTLTAAAPAS PEQIIVHALS 550
PEHLLNTSDN VTVQCHTPRV IIQTVATEDI TSSISQAELT VDSDIQSSDF 600
PEPPDALEAD TFPDEIHHPK MTVEPSFNDA HVSKFSDQNS TELMNSVMVR 650
TEEEISDTDL KQEESPSDLA SAYVTEGLES PTIEEQVDQT IDDETILIVP 700
SPHGFIQASD VIDTESVLPL TTLTDPILQH HQEESNIIGS SLGSPVSEDS 750
KDVEDLVNCH 760
Length:760
Mass (Da):84,471
Last modified:November 1, 1999 - v1
Checksum:i57B3AE332F21A333
GO
Isoform 2 (identifier: Q9Y222-2) [UniParc]FASTAAdd to Basket

Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     238-273: LRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNT → QLWTPKKGHTFKLWLSKYCCPQLPNQSNGKKKNEE
     274-760: Missing.

Show »
Length:272
Mass (Da):31,227
Checksum:i0D3F2715231DAED9
GO
Isoform 3 (identifier: Q9Y222-3) [UniParc]FASTAAdd to Basket

Also known as: Gamma

The sequence of this isoform differs from the canonical sequence as follows:
     238-285: LRIKHGNDWA...WTEEEEKRLA → KKAIAACFFF...QSNGKKKNEE
     286-760: Missing.

Show »
Length:285
Mass (Da):32,749
Checksum:i0DBCC4F2345C48BF
GO
Isoform 4 (identifier: Q9Y222-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     37-78: EADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPL → V
     238-285: LRIKHGNDWA...WTEEEEKRLA → KKAIAACFFF...QSNGKKKNEE
     286-760: Missing.

Show »
Length:244
Mass (Da):28,296
Checksum:i59F912F2CC8082E7
GO
Isoform 5 (identifier: Q9Y222-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-88: Missing.

Show »
Length:672
Mass (Da):74,878
Checksum:i818B4CFA4326350C
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti479 – 4791V → I.
Corresponds to variant rs1558049 [ dbSNP | Ensembl ].
VAR_039577

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8888Missing in isoform 5.
VSP_041063Add
BLAST
Alternative sequencei37 – 7842EADEI…VALPL → V in isoform 4.
VSP_032089Add
BLAST
Alternative sequencei238 – 28548LRIKH…EKRLA → KKAIAACFFFTHRQLWTPKK GHTFKLWLSKYCCPQLPNQS NGKKKNEE in isoform 3 and isoform 4.
VSP_032090Add
BLAST
Alternative sequencei238 – 27336LRIKH…DTCNT → QLWTPKKGHTFKLWLSKYCC PQLPNQSNGKKKNEE in isoform 2.
VSP_032091Add
BLAST
Alternative sequencei274 – 760487Missing in isoform 2.
VSP_032092Add
BLAST
Alternative sequencei286 – 760475Missing in isoform 3 and isoform 4.
VSP_032093Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti345 – 3451I → T in BAG58937. 1 Publication
Sequence conflicti616 – 6161I → V in AAH70064. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF084530 mRNA. Translation: AAC33480.1.
AF202144 mRNA. Translation: AAG35613.1.
AF202145 mRNA. Translation: AAG35614.1.
AK296211 mRNA. Translation: BAG58937.1.
AK126664 mRNA. No translation available.
AK314622 mRNA. Translation: BAG37188.1.
AB209230 mRNA. Translation: BAD92467.1. Sequence problems.
AC005076 Genomic DNA. Translation: AAD43181.1.
CH471091 Genomic DNA. Translation: EAW76963.1.
BC007418 mRNA. Translation: AAH07418.2.
BC007447 mRNA. Translation: AAH07447.2.
BC029370 mRNA. Translation: AAH29370.1. Different termination.
BC070064 mRNA. Translation: AAH70064.1.
CCDSiCCDS47633.1. [Q9Y222-5]
CCDS5601.1. [Q9Y222-1]
RefSeqiNP_001135798.1. NM_001142326.1. [Q9Y222-5]
NP_001135799.1. NM_001142327.1. [Q9Y222-1]
NP_066968.3. NM_021145.3. [Q9Y222-1]
XP_005250791.1. XM_005250734.2. [Q9Y222-1]
XP_006716265.1. XM_006716202.1. [Q9Y222-1]
UniGeneiHs.196129.

Genome annotation databases

EnsembliENST00000331242; ENSP00000332171; ENSG00000135164. [Q9Y222-1]
ENST00000394702; ENSP00000378192; ENSG00000135164. [Q9Y222-3]
ENST00000394703; ENSP00000378193; ENSG00000135164. [Q9Y222-1]
ENST00000411766; ENSP00000396570; ENSG00000135164. [Q9Y222-4]
ENST00000412139; ENSP00000407941; ENSG00000135164. [Q9Y222-2]
ENST00000425406; ENSP00000411908; ENSG00000135164. [Q9Y222-4]
ENST00000432937; ENSP00000412532; ENSG00000135164. [Q9Y222-5]
ENST00000447863; ENSP00000389774; ENSG00000135164. [Q9Y222-3]
ENST00000579677; ENSP00000464596; ENSG00000135164. [Q9Y222-2]
ENST00000584619; ENSP00000464092; ENSG00000135164. [Q9Y222-2]
GeneIDi9988.
KEGGihsa:9988.
UCSCiuc003uih.3. human. [Q9Y222-1]
uc003uim.1. human. [Q9Y222-2]

Polymorphism databases

DMDMi74762040.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF084530 mRNA. Translation: AAC33480.1 .
AF202144 mRNA. Translation: AAG35613.1 .
AF202145 mRNA. Translation: AAG35614.1 .
AK296211 mRNA. Translation: BAG58937.1 .
AK126664 mRNA. No translation available.
AK314622 mRNA. Translation: BAG37188.1 .
AB209230 mRNA. Translation: BAD92467.1 . Sequence problems.
AC005076 Genomic DNA. Translation: AAD43181.1 .
CH471091 Genomic DNA. Translation: EAW76963.1 .
BC007418 mRNA. Translation: AAH07418.2 .
BC007447 mRNA. Translation: AAH07447.2 .
BC029370 mRNA. Translation: AAH29370.1 . Different termination.
BC070064 mRNA. Translation: AAH70064.1 .
CCDSi CCDS47633.1. [Q9Y222-5 ]
CCDS5601.1. [Q9Y222-1 ]
RefSeqi NP_001135798.1. NM_001142326.1. [Q9Y222-5 ]
NP_001135799.1. NM_001142327.1. [Q9Y222-1 ]
NP_066968.3. NM_021145.3. [Q9Y222-1 ]
XP_005250791.1. XM_005250734.2. [Q9Y222-1 ]
XP_006716265.1. XM_006716202.1. [Q9Y222-1 ]
UniGenei Hs.196129.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2LLK NMR - A 220-274 [» ]
ProteinModelPortali Q9Y222.
SMRi Q9Y222. Positions 220-344.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115309. 2 interactions.
IntActi Q9Y222. 3 interactions.
MINTi MINT-1196157.
STRINGi 9606.ENSP00000332171.

PTM databases

PhosphoSitei Q9Y222.

Polymorphism databases

DMDMi 74762040.

Proteomic databases

MaxQBi Q9Y222.
PaxDbi Q9Y222.
PRIDEi Q9Y222.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000331242 ; ENSP00000332171 ; ENSG00000135164 . [Q9Y222-1 ]
ENST00000394702 ; ENSP00000378192 ; ENSG00000135164 . [Q9Y222-3 ]
ENST00000394703 ; ENSP00000378193 ; ENSG00000135164 . [Q9Y222-1 ]
ENST00000411766 ; ENSP00000396570 ; ENSG00000135164 . [Q9Y222-4 ]
ENST00000412139 ; ENSP00000407941 ; ENSG00000135164 . [Q9Y222-2 ]
ENST00000425406 ; ENSP00000411908 ; ENSG00000135164 . [Q9Y222-4 ]
ENST00000432937 ; ENSP00000412532 ; ENSG00000135164 . [Q9Y222-5 ]
ENST00000447863 ; ENSP00000389774 ; ENSG00000135164 . [Q9Y222-3 ]
ENST00000579677 ; ENSP00000464596 ; ENSG00000135164 . [Q9Y222-2 ]
ENST00000584619 ; ENSP00000464092 ; ENSG00000135164 . [Q9Y222-2 ]
GeneIDi 9988.
KEGGi hsa:9988.
UCSCi uc003uih.3. human. [Q9Y222-1 ]
uc003uim.1. human. [Q9Y222-2 ]

Organism-specific databases

CTDi 9988.
GeneCardsi GC07P086781.
H-InvDB HIX0006815.
HGNCi HGNC:14603. DMTF1.
HPAi HPA023846.
MIMi 608491. gene.
neXtProti NX_Q9Y222.
PharmGKBi PA27389.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG288590.
HOVERGENi HBG053416.
InParanoidi Q9Y222.
OMAi TDPILQH.
OrthoDBi EOG7QZG92.
PhylomeDBi Q9Y222.
TreeFami TF333537.

Miscellaneous databases

ChiTaRSi DMTF1. human.
GeneWikii DMTF1.
GenomeRNAii 9988.
NextBioi 37719.
PROi Q9Y222.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9Y222.
Bgeei Q9Y222.
CleanExi HS_DMP1.
HS_DMTF1.
Genevestigatori Q9Y222.

Family and domain databases

Gene3Di 1.10.10.60. 2 hits.
InterProi IPR009057. Homeodomain-like.
IPR017877. Myb-like_dom.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
[Graphical view ]
Pfami PF00249. Myb_DNA-binding. 2 hits.
[Graphical view ]
SMARTi SM00717. SANT. 3 hits.
[Graphical view ]
SUPFAMi SSF46689. SSF46689. 3 hits.
PROSITEi PS51294. HTH_MYB. 1 hit.
PS50090. MYB_LIKE. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and chromosomal localization of the gene encoding human cyclin D-binding Myb-like protein (hDMP1)."
    Bodner S.M., Naeve C.W., Rakestraw K.M., Jones B.G., Valentine V.A., Valentine M.B., Luthardt F.W., Willman C.L., Raimondi S.C., Downing J.R., Roussel M.F., Sherr C.J., Look A.T.
    Gene 229:223-228(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "Alternative splicing of the human cyclin D-binding Myb-like protein (hDMP1) yields a truncated protein isoform that alters macrophage differentiation patterns."
    Tschan M.P., Fischer K.M., Fung V.S., Pirnia F., Borner M.M., Fey M.F., Tobler A., Torbett B.E.
    J. Biol. Chem. 278:42750-42760(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, TISSUE SPECIFICITY.
    Tissue: Chronic myeloid leukemia cell.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 5).
    Tissue: Cerebellum, Placenta and Thalamus.
  4. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Brain.
  5. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Muscle, Placenta and Testis.
  8. Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiDMTF1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y222
Secondary accession number(s): B2RBE1
, B4DJS5, Q05C48, Q59G79, Q6IS13, Q969T2, Q9H2Z2, Q9H2Z3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: November 1, 1999
Last modified: July 9, 2014
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi