Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-D-binding Myb-like transcription factor 1

Gene

DMTF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional activator which activates the CDKN2A/ARF locus in response to Ras-Raf signaling, thereby promoting p53/TP53-dependent growth arrest (By similarity). Binds to the consensus sequence 5'-CCCG[GT]ATGT-3' (By similarity). Isoform 1 may cooperate with MYB to activate transcription of the ANPEP gene. Isoform 2 may antagonize transcriptional activation by isoform 1.By similarity1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi306 – 32924H-T-H motifPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  • chromatin binding Source: InterPro
  • DNA binding Source: UniProtKB-KW
  • sequence-specific DNA binding transcription factor activity Source: UniProtKB

GO - Biological processi

  • cell cycle Source: UniProtKB-KW
  • regulation of transcription, DNA-templated Source: UniProtKB
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Cell cycle, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-D-binding Myb-like transcription factor 1
Short name:
hDMTF1
Alternative name(s):
Cyclin-D-interacting Myb-like protein 1
Short name:
hDMP1
Gene namesi
Name:DMTF1
Synonyms:DMP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:14603. DMTF1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HPA
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

PharmGKBiPA27389.

Polymorphism and mutation databases

BioMutaiDMTF1.
DMDMi74762040.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 760760Cyclin-D-binding Myb-like transcription factor 1PRO_0000323729Add
BLAST

Post-translational modificationi

Phosphorylated by the cyclin-D2/CDK4, cyclin-D3/CDK4 and cyclin-D2/CDK6 complexes and to a lesser extent by the cyclin-D1/CDK4 complex.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9Y222.
PaxDbiQ9Y222.
PRIDEiQ9Y222.

PTM databases

PhosphoSiteiQ9Y222.

Expressioni

Tissue specificityi

Expressed at relatively low levels in colonic mucosa, ovary, peripheral leukocytes, prostate and small intestine, and at higher levels in spleen, testis and thymus. Expressed in multiple regions of the brain and CNS including amygdala, caudate, corpus callosum, hippocampus, substantia nigra and subthalamic nucleus. Isoform 1 is the predominant isoform in monocytes, macrophages and neutrophils, isoform 2 is most strongly expressed in peripheral blood leukocytes and quiescent CD34 positive cells, and isoform 3 is expressed at low levels in all hematopoietic cell types. Expression is frequently reduced in non-small-cell lung carcinomas (NSCLC) due to hemizygous gene deletion, strongly suggesting that this locus is haploinsufficient for tumor suppression. Loss of this locus frequently occurs in tumors which retain wild-type CDKN2A/ARF and p53/TP53 loci. Hemizygous gene deletion has also been observed in leukemic blasts from patients with abnormalities of the long arm of chromosome 7.3 Publications

Developmental stagei

Isoform 2 expression is down-regulated during myeloid differentiation, while the expression of isoform 1 and isoform 3 remain constant.

Gene expression databases

BgeeiQ9Y222.
CleanExiHS_DMP1.
HS_DMTF1.
ExpressionAtlasiQ9Y222. baseline and differential.
GenevisibleiQ9Y222. HS.

Organism-specific databases

HPAiHPA023846.

Interactioni

Subunit structurei

Interacts with the D-type cyclins CCND1, CCND2 and CCND3. Interaction with D-type cyclins may modulate transcriptional activation by this protein.By similarity

Protein-protein interaction databases

BioGridi115309. 2 interactions.
IntActiQ9Y222. 3 interactions.
MINTiMINT-1196157.
STRINGi9606.ENSP00000332171.

Structurei

Secondary structure

1
760
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi229 – 24214Combined sources
Helixi246 – 2538Combined sources
Helixi257 – 26610Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2LLKNMR-A220-274[»]
ProteinModelPortaliQ9Y222.
SMRiQ9Y222. Positions 220-344.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini225 – 26339Myb-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini268 – 33366HTH myb-typePROSITE-ProRule annotationAdd
BLAST
Domaini339 – 38850Myb-like 2PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 237237Interaction with CCND2By similarityAdd
BLAST
Regioni87 – 458372Required for DNA-bindingBy similarityAdd
BLAST
Regioni87 – 17084Required for transcriptional activationBy similarityAdd
BLAST
Regioni176 – 760585Interaction with CCND1, CCND2 and CCND3By similarityAdd
BLAST
Regioni459 – 760302Required for transcriptional activationBy similarityAdd
BLAST

Sequence similaritiesi

Belongs to the DMTF1 family.Curated
Contains 1 HTH myb-type DNA-binding domain.PROSITE-ProRule annotation
Contains 2 Myb-like domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG288590.
GeneTreeiENSGT00530000063659.
HOVERGENiHBG053416.
InParanoidiQ9Y222.
OMAiFPDEIHQ.
OrthoDBiEOG7QZG92.
PhylomeDBiQ9Y222.
TreeFamiTF333537.

Family and domain databases

Gene3Di1.10.10.60. 2 hits.
InterProiIPR009057. Homeodomain-like.
IPR017877. Myb-like_dom.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
[Graphical view]
PfamiPF00249. Myb_DNA-binding. 2 hits.
[Graphical view]
SMARTiSM00717. SANT. 3 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 3 hits.
PROSITEiPS51294. HTH_MYB. 1 hit.
PS50090. MYB_LIKE. 2 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9Y222-1) [UniParc]FASTAAdd to basket

Also known as: Alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSTVEEDSDT VTVETVNSVT LTQDTEGNLI LHCPQNEADE IDSEDSIEPP
60 70 80 90 100
HKRLCLSSED DQSIDDSTPC ISVVALPLSE NDQSFEVTMT ATTEVADDEV
110 120 130 140 150
TEGTVTQIQI LQNEQLDEIS PLGNEEVSAV SQAWFTTKED KDSLTNKGHK
160 170 180 190 200
WKQGMWSKEE IDILMNNIER YLKARGIKDA TEIIFEMSKD ERKDFYRTIA
210 220 230 240 250
WGLNRPLFAV YRRVLRMYDD RNHVGKYTPE EIEKLKELRI KHGNDWATIG
260 270 280 290 300
AALGRSASSV KDRCRLMKDT CNTGKWTEEE EKRLAEVVHE LTSTEPGDIV
310 320 330 340 350
TQGVSWAAVA ERVGTRSEKQ CRSKWLNYLN WKQSGGTEWT KEDEINLILR
360 370 380 390 400
IAELDVADEN DINWDLLAEG WSSVRSPQWL RSKWWTIKRQ IANHKDVSFP
410 420 430 440 450
VLIKGLKQLH ENQKNNPTLL ENKSGSGVPN SNTNSSVQHV QIRVARLEDN
460 470 480 490 500
TAISSSPMAA LQIPVQITHV SSADSPATVD SETITLNSGT LQTFEILPSF
510 520 530 540 550
HLQPTGTPGT YLLQTSSSQG LPLTLTASPT VTLTAAAPAS PEQIIVHALS
560 570 580 590 600
PEHLLNTSDN VTVQCHTPRV IIQTVATEDI TSSISQAELT VDSDIQSSDF
610 620 630 640 650
PEPPDALEAD TFPDEIHHPK MTVEPSFNDA HVSKFSDQNS TELMNSVMVR
660 670 680 690 700
TEEEISDTDL KQEESPSDLA SAYVTEGLES PTIEEQVDQT IDDETILIVP
710 720 730 740 750
SPHGFIQASD VIDTESVLPL TTLTDPILQH HQEESNIIGS SLGSPVSEDS
760
KDVEDLVNCH
Length:760
Mass (Da):84,471
Last modified:November 1, 1999 - v1
Checksum:i57B3AE332F21A333
GO
Isoform 2 (identifier: Q9Y222-2) [UniParc]FASTAAdd to basket

Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     238-273: LRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNT → QLWTPKKGHTFKLWLSKYCCPQLPNQSNGKKKNEE
     274-760: Missing.

Show »
Length:272
Mass (Da):31,227
Checksum:i0D3F2715231DAED9
GO
Isoform 3 (identifier: Q9Y222-3) [UniParc]FASTAAdd to basket

Also known as: Gamma

The sequence of this isoform differs from the canonical sequence as follows:
     238-285: LRIKHGNDWA...WTEEEEKRLA → KKAIAACFFF...QSNGKKKNEE
     286-760: Missing.

Show »
Length:285
Mass (Da):32,749
Checksum:i0DBCC4F2345C48BF
GO
Isoform 4 (identifier: Q9Y222-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     37-78: EADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPL → V
     238-285: LRIKHGNDWA...WTEEEEKRLA → KKAIAACFFF...QSNGKKKNEE
     286-760: Missing.

Show »
Length:244
Mass (Da):28,296
Checksum:i59F912F2CC8082E7
GO
Isoform 5 (identifier: Q9Y222-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-88: Missing.

Show »
Length:672
Mass (Da):74,878
Checksum:i818B4CFA4326350C
GO

Sequence cautioni

The sequence BAD92467.1 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti345 – 3451I → T in BAG58937 (PubMed:14702039).Curated
Sequence conflicti616 – 6161I → V in AAH70064 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti479 – 4791V → I.
Corresponds to variant rs1558049 [ dbSNP | Ensembl ].
VAR_039577

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8888Missing in isoform 5. 1 PublicationVSP_041063Add
BLAST
Alternative sequencei37 – 7842EADEI…VALPL → V in isoform 4. 1 PublicationVSP_032089Add
BLAST
Alternative sequencei238 – 28548LRIKH…EKRLA → KKAIAACFFFTHRQLWTPKK GHTFKLWLSKYCCPQLPNQS NGKKKNEE in isoform 3 and isoform 4. 2 PublicationsVSP_032090Add
BLAST
Alternative sequencei238 – 27336LRIKH…DTCNT → QLWTPKKGHTFKLWLSKYCC PQLPNQSNGKKKNEE in isoform 2. 2 PublicationsVSP_032091Add
BLAST
Alternative sequencei274 – 760487Missing in isoform 2. 2 PublicationsVSP_032092Add
BLAST
Alternative sequencei286 – 760475Missing in isoform 3 and isoform 4. 2 PublicationsVSP_032093Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF084530 mRNA. Translation: AAC33480.1.
AF202144 mRNA. Translation: AAG35613.1.
AF202145 mRNA. Translation: AAG35614.1.
AK296211 mRNA. Translation: BAG58937.1.
AK126664 mRNA. No translation available.
AK314622 mRNA. Translation: BAG37188.1.
AB209230 mRNA. Translation: BAD92467.1. Sequence problems.
AC005076 Genomic DNA. Translation: AAD43181.1.
CH471091 Genomic DNA. Translation: EAW76963.1.
BC007418 mRNA. Translation: AAH07418.2.
BC007447 mRNA. Translation: AAH07447.2.
BC029370 mRNA. Translation: AAH29370.1. Different termination.
BC070064 mRNA. Translation: AAH70064.1.
CCDSiCCDS47633.1. [Q9Y222-5]
CCDS5601.1. [Q9Y222-1]
RefSeqiNP_001135798.1. NM_001142326.1. [Q9Y222-5]
NP_001135799.1. NM_001142327.1. [Q9Y222-1]
NP_066968.3. NM_021145.3. [Q9Y222-1]
XP_005250791.1. XM_005250734.2. [Q9Y222-1]
XP_006716265.1. XM_006716202.1. [Q9Y222-1]
XP_011515033.1. XM_011516731.1. [Q9Y222-1]
XP_011515034.1. XM_011516732.1. [Q9Y222-1]
XP_011515035.1. XM_011516733.1. [Q9Y222-1]
XP_011515036.1. XM_011516734.1. [Q9Y222-1]
XP_011515037.1. XM_011516735.1. [Q9Y222-1]
XP_011515038.1. XM_011516736.1. [Q9Y222-1]
XP_011515039.1. XM_011516737.1. [Q9Y222-1]
UniGeneiHs.196129.

Genome annotation databases

EnsembliENST00000331242; ENSP00000332171; ENSG00000135164.
ENST00000394703; ENSP00000378193; ENSG00000135164.
ENST00000412139; ENSP00000407941; ENSG00000135164. [Q9Y222-2]
ENST00000425406; ENSP00000411908; ENSG00000135164. [Q9Y222-4]
ENST00000432937; ENSP00000412532; ENSG00000135164. [Q9Y222-5]
ENST00000447863; ENSP00000389774; ENSG00000135164. [Q9Y222-3]
ENST00000579677; ENSP00000464596; ENSG00000135164. [Q9Y222-2]
ENST00000584619; ENSP00000464092; ENSG00000135164. [Q9Y222-2]
GeneIDi9988.
KEGGihsa:9988.
UCSCiuc003uih.3. human. [Q9Y222-1]
uc003uim.1. human. [Q9Y222-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF084530 mRNA. Translation: AAC33480.1.
AF202144 mRNA. Translation: AAG35613.1.
AF202145 mRNA. Translation: AAG35614.1.
AK296211 mRNA. Translation: BAG58937.1.
AK126664 mRNA. No translation available.
AK314622 mRNA. Translation: BAG37188.1.
AB209230 mRNA. Translation: BAD92467.1. Sequence problems.
AC005076 Genomic DNA. Translation: AAD43181.1.
CH471091 Genomic DNA. Translation: EAW76963.1.
BC007418 mRNA. Translation: AAH07418.2.
BC007447 mRNA. Translation: AAH07447.2.
BC029370 mRNA. Translation: AAH29370.1. Different termination.
BC070064 mRNA. Translation: AAH70064.1.
CCDSiCCDS47633.1. [Q9Y222-5]
CCDS5601.1. [Q9Y222-1]
RefSeqiNP_001135798.1. NM_001142326.1. [Q9Y222-5]
NP_001135799.1. NM_001142327.1. [Q9Y222-1]
NP_066968.3. NM_021145.3. [Q9Y222-1]
XP_005250791.1. XM_005250734.2. [Q9Y222-1]
XP_006716265.1. XM_006716202.1. [Q9Y222-1]
XP_011515033.1. XM_011516731.1. [Q9Y222-1]
XP_011515034.1. XM_011516732.1. [Q9Y222-1]
XP_011515035.1. XM_011516733.1. [Q9Y222-1]
XP_011515036.1. XM_011516734.1. [Q9Y222-1]
XP_011515037.1. XM_011516735.1. [Q9Y222-1]
XP_011515038.1. XM_011516736.1. [Q9Y222-1]
XP_011515039.1. XM_011516737.1. [Q9Y222-1]
UniGeneiHs.196129.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2LLKNMR-A220-274[»]
ProteinModelPortaliQ9Y222.
SMRiQ9Y222. Positions 220-344.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115309. 2 interactions.
IntActiQ9Y222. 3 interactions.
MINTiMINT-1196157.
STRINGi9606.ENSP00000332171.

PTM databases

PhosphoSiteiQ9Y222.

Polymorphism and mutation databases

BioMutaiDMTF1.
DMDMi74762040.

Proteomic databases

MaxQBiQ9Y222.
PaxDbiQ9Y222.
PRIDEiQ9Y222.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000331242; ENSP00000332171; ENSG00000135164.
ENST00000394703; ENSP00000378193; ENSG00000135164.
ENST00000412139; ENSP00000407941; ENSG00000135164. [Q9Y222-2]
ENST00000425406; ENSP00000411908; ENSG00000135164. [Q9Y222-4]
ENST00000432937; ENSP00000412532; ENSG00000135164. [Q9Y222-5]
ENST00000447863; ENSP00000389774; ENSG00000135164. [Q9Y222-3]
ENST00000579677; ENSP00000464596; ENSG00000135164. [Q9Y222-2]
ENST00000584619; ENSP00000464092; ENSG00000135164. [Q9Y222-2]
GeneIDi9988.
KEGGihsa:9988.
UCSCiuc003uih.3. human. [Q9Y222-1]
uc003uim.1. human. [Q9Y222-2]

Organism-specific databases

CTDi9988.
GeneCardsiGC07P086781.
H-InvDBHIX0006815.
HGNCiHGNC:14603. DMTF1.
HPAiHPA023846.
MIMi608491. gene.
neXtProtiNX_Q9Y222.
PharmGKBiPA27389.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG288590.
GeneTreeiENSGT00530000063659.
HOVERGENiHBG053416.
InParanoidiQ9Y222.
OMAiFPDEIHQ.
OrthoDBiEOG7QZG92.
PhylomeDBiQ9Y222.
TreeFamiTF333537.

Miscellaneous databases

ChiTaRSiDMTF1. human.
GeneWikiiDMTF1.
GenomeRNAii9988.
NextBioi37719.
PROiQ9Y222.
SOURCEiSearch...

Gene expression databases

BgeeiQ9Y222.
CleanExiHS_DMP1.
HS_DMTF1.
ExpressionAtlasiQ9Y222. baseline and differential.
GenevisibleiQ9Y222. HS.

Family and domain databases

Gene3Di1.10.10.60. 2 hits.
InterProiIPR009057. Homeodomain-like.
IPR017877. Myb-like_dom.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
[Graphical view]
PfamiPF00249. Myb_DNA-binding. 2 hits.
[Graphical view]
SMARTiSM00717. SANT. 3 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 3 hits.
PROSITEiPS51294. HTH_MYB. 1 hit.
PS50090. MYB_LIKE. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and chromosomal localization of the gene encoding human cyclin D-binding Myb-like protein (hDMP1)."
    Bodner S.M., Naeve C.W., Rakestraw K.M., Jones B.G., Valentine V.A., Valentine M.B., Luthardt F.W., Willman C.L., Raimondi S.C., Downing J.R., Roussel M.F., Sherr C.J., Look A.T.
    Gene 229:223-228(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "Alternative splicing of the human cyclin D-binding Myb-like protein (hDMP1) yields a truncated protein isoform that alters macrophage differentiation patterns."
    Tschan M.P., Fischer K.M., Fung V.S., Pirnia F., Borner M.M., Fey M.F., Tobler A., Torbett B.E.
    J. Biol. Chem. 278:42750-42760(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, TISSUE SPECIFICITY.
    Tissue: Chronic myeloid leukemia cell.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 5).
    Tissue: Cerebellum, Placenta and Thalamus.
  4. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Brain.
  5. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Muscle, Placenta and Testis.
  8. Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiDMTF1_HUMAN
AccessioniPrimary (citable) accession number: Q9Y222
Secondary accession number(s): B2RBE1
, B4DJS5, Q05C48, Q59G79, Q6IS13, Q969T2, Q9H2Z2, Q9H2Z3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: November 1, 1999
Last modified: July 22, 2015
This is version 125 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.