Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9Y222

- DMTF1_HUMAN

UniProt

Q9Y222 - DMTF1_HUMAN

Protein

Cyclin-D-binding Myb-like transcription factor 1

Gene

DMTF1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 118 (01 Oct 2014)
      Sequence version 1 (01 Nov 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcriptional activator which activates the CDKN2A/ARF locus in response to Ras-Raf signaling, thereby promoting p53/TP53-dependent growth arrest By similarity. Binds to the consensus sequence 5'-CCCG[GT]ATGT-3' By similarity. Isoform 1 may cooperate with MYB to activate transcription of the ANPEP gene. Isoform 2 may antagonize transcriptional activation by isoform 1.By similarity1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi306 – 32924H-T-H motifPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. chromatin binding Source: InterPro
    2. DNA binding Source: UniProtKB-KW
    3. sequence-specific DNA binding transcription factor activity Source: UniProtKB

    GO - Biological processi

    1. cell cycle Source: UniProtKB-KW
    2. regulation of transcription, DNA-templated Source: UniProtKB
    3. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Cell cycle, Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cyclin-D-binding Myb-like transcription factor 1
    Short name:
    hDMTF1
    Alternative name(s):
    Cyclin-D-interacting Myb-like protein 1
    Short name:
    hDMP1
    Gene namesi
    Name:DMTF1
    Synonyms:DMP1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:14603. DMTF1.

    Subcellular locationi

    Nucleus 1 PublicationPROSITE-ProRule annotation

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Keywords - Diseasei

    Tumor suppressor

    Organism-specific databases

    PharmGKBiPA27389.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 760760Cyclin-D-binding Myb-like transcription factor 1PRO_0000323729Add
    BLAST

    Post-translational modificationi

    Phosphorylated by the cyclin-D2/CDK4, cyclin-D3/CDK4 and cyclin-D2/CDK6 complexes and to a lesser extent by the cyclin-D1/CDK4 complex.By similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9Y222.
    PaxDbiQ9Y222.
    PRIDEiQ9Y222.

    PTM databases

    PhosphoSiteiQ9Y222.

    Expressioni

    Tissue specificityi

    Expressed at relatively low levels in colonic mucosa, ovary, peripheral leukocytes, prostate and small intestine, and at higher levels in spleen, testis and thymus. Expressed in multiple regions of the brain and CNS including amygdala, caudate, corpus callosum, hippocampus, substantia nigra and subthalamic nucleus. Isoform 1 is the predominant isoform in monocytes, macrophages and neutrophils, isoform 2 is most strongly expressed in peripheral blood leukocytes and quiescent CD34 positive cells, and isoform 3 is expressed at low levels in all hematopoietic cell types. Expression is frequently reduced in non-small-cell lung carcinomas (NSCLC) due to hemizygous gene deletion, strongly suggesting that this locus is haploinsufficient for tumor suppression. Loss of this locus frequently occurs in tumors which retain wild-type CDKN2A/ARF and p53/TP53 loci. Hemizygous gene deletion has also been observed in leukemic blasts from patients with abnormalities of the long arm of chromosome 7.3 Publications

    Developmental stagei

    Isoform 2 expression is down-regulated during myeloid differentiation, while the expression of isoform 1 and isoform 3 remain constant.

    Gene expression databases

    ArrayExpressiQ9Y222.
    BgeeiQ9Y222.
    CleanExiHS_DMP1.
    HS_DMTF1.
    GenevestigatoriQ9Y222.

    Organism-specific databases

    HPAiHPA023846.

    Interactioni

    Subunit structurei

    Interacts with the D-type cyclins CCND1, CCND2 and CCND3. Interaction with D-type cyclins may modulate transcriptional activation by this protein.By similarity

    Protein-protein interaction databases

    BioGridi115309. 2 interactions.
    IntActiQ9Y222. 3 interactions.
    MINTiMINT-1196157.
    STRINGi9606.ENSP00000332171.

    Structurei

    Secondary structure

    1
    760
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi229 – 24214
    Helixi246 – 2538
    Helixi257 – 26610

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2LLKNMR-A220-274[»]
    ProteinModelPortaliQ9Y222.
    SMRiQ9Y222. Positions 220-344.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini225 – 26339Myb-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini268 – 33366HTH myb-typePROSITE-ProRule annotationAdd
    BLAST
    Domaini339 – 38850Myb-like 2PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 237237Interaction with CCND2By similarityAdd
    BLAST
    Regioni87 – 458372Required for DNA-bindingBy similarityAdd
    BLAST
    Regioni87 – 17084Required for transcriptional activationBy similarityAdd
    BLAST
    Regioni176 – 760585Interaction with CCND1, CCND2 and CCND3By similarityAdd
    BLAST
    Regioni459 – 760302Required for transcriptional activationBy similarityAdd
    BLAST

    Sequence similaritiesi

    Belongs to the DMTF1 family.Curated
    Contains 1 HTH myb-type DNA-binding domain.PROSITE-ProRule annotation
    Contains 2 Myb-like domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG288590.
    HOVERGENiHBG053416.
    InParanoidiQ9Y222.
    OMAiTDPILQH.
    OrthoDBiEOG7QZG92.
    PhylomeDBiQ9Y222.
    TreeFamiTF333537.

    Family and domain databases

    Gene3Di1.10.10.60. 2 hits.
    InterProiIPR009057. Homeodomain-like.
    IPR017877. Myb-like_dom.
    IPR017930. Myb_dom.
    IPR001005. SANT/Myb.
    [Graphical view]
    PfamiPF00249. Myb_DNA-binding. 2 hits.
    [Graphical view]
    SMARTiSM00717. SANT. 3 hits.
    [Graphical view]
    SUPFAMiSSF46689. SSF46689. 3 hits.
    PROSITEiPS51294. HTH_MYB. 1 hit.
    PS50090. MYB_LIKE. 2 hits.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9Y222-1) [UniParc]FASTAAdd to Basket

    Also known as: Alpha

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSTVEEDSDT VTVETVNSVT LTQDTEGNLI LHCPQNEADE IDSEDSIEPP    50
    HKRLCLSSED DQSIDDSTPC ISVVALPLSE NDQSFEVTMT ATTEVADDEV 100
    TEGTVTQIQI LQNEQLDEIS PLGNEEVSAV SQAWFTTKED KDSLTNKGHK 150
    WKQGMWSKEE IDILMNNIER YLKARGIKDA TEIIFEMSKD ERKDFYRTIA 200
    WGLNRPLFAV YRRVLRMYDD RNHVGKYTPE EIEKLKELRI KHGNDWATIG 250
    AALGRSASSV KDRCRLMKDT CNTGKWTEEE EKRLAEVVHE LTSTEPGDIV 300
    TQGVSWAAVA ERVGTRSEKQ CRSKWLNYLN WKQSGGTEWT KEDEINLILR 350
    IAELDVADEN DINWDLLAEG WSSVRSPQWL RSKWWTIKRQ IANHKDVSFP 400
    VLIKGLKQLH ENQKNNPTLL ENKSGSGVPN SNTNSSVQHV QIRVARLEDN 450
    TAISSSPMAA LQIPVQITHV SSADSPATVD SETITLNSGT LQTFEILPSF 500
    HLQPTGTPGT YLLQTSSSQG LPLTLTASPT VTLTAAAPAS PEQIIVHALS 550
    PEHLLNTSDN VTVQCHTPRV IIQTVATEDI TSSISQAELT VDSDIQSSDF 600
    PEPPDALEAD TFPDEIHHPK MTVEPSFNDA HVSKFSDQNS TELMNSVMVR 650
    TEEEISDTDL KQEESPSDLA SAYVTEGLES PTIEEQVDQT IDDETILIVP 700
    SPHGFIQASD VIDTESVLPL TTLTDPILQH HQEESNIIGS SLGSPVSEDS 750
    KDVEDLVNCH 760
    Length:760
    Mass (Da):84,471
    Last modified:November 1, 1999 - v1
    Checksum:i57B3AE332F21A333
    GO
    Isoform 2 (identifier: Q9Y222-2) [UniParc]FASTAAdd to Basket

    Also known as: Beta

    The sequence of this isoform differs from the canonical sequence as follows:
         238-273: LRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNT → QLWTPKKGHTFKLWLSKYCCPQLPNQSNGKKKNEE
         274-760: Missing.

    Show »
    Length:272
    Mass (Da):31,227
    Checksum:i0D3F2715231DAED9
    GO
    Isoform 3 (identifier: Q9Y222-3) [UniParc]FASTAAdd to Basket

    Also known as: Gamma

    The sequence of this isoform differs from the canonical sequence as follows:
         238-285: LRIKHGNDWA...WTEEEEKRLA → KKAIAACFFF...QSNGKKKNEE
         286-760: Missing.

    Show »
    Length:285
    Mass (Da):32,749
    Checksum:i0DBCC4F2345C48BF
    GO
    Isoform 4 (identifier: Q9Y222-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         37-78: EADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPL → V
         238-285: LRIKHGNDWA...WTEEEEKRLA → KKAIAACFFF...QSNGKKKNEE
         286-760: Missing.

    Show »
    Length:244
    Mass (Da):28,296
    Checksum:i59F912F2CC8082E7
    GO
    Isoform 5 (identifier: Q9Y222-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-88: Missing.

    Show »
    Length:672
    Mass (Da):74,878
    Checksum:i818B4CFA4326350C
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti345 – 3451I → T in BAG58937. (PubMed:14702039)Curated
    Sequence conflicti616 – 6161I → V in AAH70064. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti479 – 4791V → I.
    Corresponds to variant rs1558049 [ dbSNP | Ensembl ].
    VAR_039577

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 8888Missing in isoform 5. 1 PublicationVSP_041063Add
    BLAST
    Alternative sequencei37 – 7842EADEI…VALPL → V in isoform 4. 1 PublicationVSP_032089Add
    BLAST
    Alternative sequencei238 – 28548LRIKH…EKRLA → KKAIAACFFFTHRQLWTPKK GHTFKLWLSKYCCPQLPNQS NGKKKNEE in isoform 3 and isoform 4. 2 PublicationsVSP_032090Add
    BLAST
    Alternative sequencei238 – 27336LRIKH…DTCNT → QLWTPKKGHTFKLWLSKYCC PQLPNQSNGKKKNEE in isoform 2. 2 PublicationsVSP_032091Add
    BLAST
    Alternative sequencei274 – 760487Missing in isoform 2. 2 PublicationsVSP_032092Add
    BLAST
    Alternative sequencei286 – 760475Missing in isoform 3 and isoform 4. 2 PublicationsVSP_032093Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF084530 mRNA. Translation: AAC33480.1.
    AF202144 mRNA. Translation: AAG35613.1.
    AF202145 mRNA. Translation: AAG35614.1.
    AK296211 mRNA. Translation: BAG58937.1.
    AK126664 mRNA. No translation available.
    AK314622 mRNA. Translation: BAG37188.1.
    AB209230 mRNA. Translation: BAD92467.1. Sequence problems.
    AC005076 Genomic DNA. Translation: AAD43181.1.
    CH471091 Genomic DNA. Translation: EAW76963.1.
    BC007418 mRNA. Translation: AAH07418.2.
    BC007447 mRNA. Translation: AAH07447.2.
    BC029370 mRNA. Translation: AAH29370.1. Different termination.
    BC070064 mRNA. Translation: AAH70064.1.
    CCDSiCCDS47633.1. [Q9Y222-5]
    CCDS5601.1. [Q9Y222-1]
    RefSeqiNP_001135798.1. NM_001142326.1. [Q9Y222-5]
    NP_001135799.1. NM_001142327.1. [Q9Y222-1]
    NP_066968.3. NM_021145.3. [Q9Y222-1]
    XP_005250791.1. XM_005250734.2. [Q9Y222-1]
    XP_006716265.1. XM_006716202.1. [Q9Y222-1]
    UniGeneiHs.196129.

    Genome annotation databases

    EnsembliENST00000331242; ENSP00000332171; ENSG00000135164. [Q9Y222-1]
    ENST00000394703; ENSP00000378193; ENSG00000135164. [Q9Y222-1]
    ENST00000412139; ENSP00000407941; ENSG00000135164. [Q9Y222-2]
    ENST00000425406; ENSP00000411908; ENSG00000135164. [Q9Y222-4]
    ENST00000432937; ENSP00000412532; ENSG00000135164. [Q9Y222-5]
    ENST00000447863; ENSP00000389774; ENSG00000135164. [Q9Y222-3]
    ENST00000579677; ENSP00000464596; ENSG00000135164. [Q9Y222-2]
    ENST00000584619; ENSP00000464092; ENSG00000135164. [Q9Y222-2]
    GeneIDi9988.
    KEGGihsa:9988.
    UCSCiuc003uih.3. human. [Q9Y222-1]
    uc003uim.1. human. [Q9Y222-2]

    Polymorphism databases

    DMDMi74762040.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF084530 mRNA. Translation: AAC33480.1 .
    AF202144 mRNA. Translation: AAG35613.1 .
    AF202145 mRNA. Translation: AAG35614.1 .
    AK296211 mRNA. Translation: BAG58937.1 .
    AK126664 mRNA. No translation available.
    AK314622 mRNA. Translation: BAG37188.1 .
    AB209230 mRNA. Translation: BAD92467.1 . Sequence problems.
    AC005076 Genomic DNA. Translation: AAD43181.1 .
    CH471091 Genomic DNA. Translation: EAW76963.1 .
    BC007418 mRNA. Translation: AAH07418.2 .
    BC007447 mRNA. Translation: AAH07447.2 .
    BC029370 mRNA. Translation: AAH29370.1 . Different termination.
    BC070064 mRNA. Translation: AAH70064.1 .
    CCDSi CCDS47633.1. [Q9Y222-5 ]
    CCDS5601.1. [Q9Y222-1 ]
    RefSeqi NP_001135798.1. NM_001142326.1. [Q9Y222-5 ]
    NP_001135799.1. NM_001142327.1. [Q9Y222-1 ]
    NP_066968.3. NM_021145.3. [Q9Y222-1 ]
    XP_005250791.1. XM_005250734.2. [Q9Y222-1 ]
    XP_006716265.1. XM_006716202.1. [Q9Y222-1 ]
    UniGenei Hs.196129.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2LLK NMR - A 220-274 [» ]
    ProteinModelPortali Q9Y222.
    SMRi Q9Y222. Positions 220-344.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115309. 2 interactions.
    IntActi Q9Y222. 3 interactions.
    MINTi MINT-1196157.
    STRINGi 9606.ENSP00000332171.

    PTM databases

    PhosphoSitei Q9Y222.

    Polymorphism databases

    DMDMi 74762040.

    Proteomic databases

    MaxQBi Q9Y222.
    PaxDbi Q9Y222.
    PRIDEi Q9Y222.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000331242 ; ENSP00000332171 ; ENSG00000135164 . [Q9Y222-1 ]
    ENST00000394703 ; ENSP00000378193 ; ENSG00000135164 . [Q9Y222-1 ]
    ENST00000412139 ; ENSP00000407941 ; ENSG00000135164 . [Q9Y222-2 ]
    ENST00000425406 ; ENSP00000411908 ; ENSG00000135164 . [Q9Y222-4 ]
    ENST00000432937 ; ENSP00000412532 ; ENSG00000135164 . [Q9Y222-5 ]
    ENST00000447863 ; ENSP00000389774 ; ENSG00000135164 . [Q9Y222-3 ]
    ENST00000579677 ; ENSP00000464596 ; ENSG00000135164 . [Q9Y222-2 ]
    ENST00000584619 ; ENSP00000464092 ; ENSG00000135164 . [Q9Y222-2 ]
    GeneIDi 9988.
    KEGGi hsa:9988.
    UCSCi uc003uih.3. human. [Q9Y222-1 ]
    uc003uim.1. human. [Q9Y222-2 ]

    Organism-specific databases

    CTDi 9988.
    GeneCardsi GC07P086781.
    H-InvDB HIX0006815.
    HGNCi HGNC:14603. DMTF1.
    HPAi HPA023846.
    MIMi 608491. gene.
    neXtProti NX_Q9Y222.
    PharmGKBi PA27389.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG288590.
    HOVERGENi HBG053416.
    InParanoidi Q9Y222.
    OMAi TDPILQH.
    OrthoDBi EOG7QZG92.
    PhylomeDBi Q9Y222.
    TreeFami TF333537.

    Miscellaneous databases

    ChiTaRSi DMTF1. human.
    GeneWikii DMTF1.
    GenomeRNAii 9988.
    NextBioi 37719.
    PROi Q9Y222.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9Y222.
    Bgeei Q9Y222.
    CleanExi HS_DMP1.
    HS_DMTF1.
    Genevestigatori Q9Y222.

    Family and domain databases

    Gene3Di 1.10.10.60. 2 hits.
    InterProi IPR009057. Homeodomain-like.
    IPR017877. Myb-like_dom.
    IPR017930. Myb_dom.
    IPR001005. SANT/Myb.
    [Graphical view ]
    Pfami PF00249. Myb_DNA-binding. 2 hits.
    [Graphical view ]
    SMARTi SM00717. SANT. 3 hits.
    [Graphical view ]
    SUPFAMi SSF46689. SSF46689. 3 hits.
    PROSITEi PS51294. HTH_MYB. 1 hit.
    PS50090. MYB_LIKE. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and chromosomal localization of the gene encoding human cyclin D-binding Myb-like protein (hDMP1)."
      Bodner S.M., Naeve C.W., Rakestraw K.M., Jones B.G., Valentine V.A., Valentine M.B., Luthardt F.W., Willman C.L., Raimondi S.C., Downing J.R., Roussel M.F., Sherr C.J., Look A.T.
      Gene 229:223-228(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    2. "Alternative splicing of the human cyclin D-binding Myb-like protein (hDMP1) yields a truncated protein isoform that alters macrophage differentiation patterns."
      Tschan M.P., Fischer K.M., Fung V.S., Pirnia F., Borner M.M., Fey M.F., Tobler A., Torbett B.E.
      J. Biol. Chem. 278:42750-42760(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, TISSUE SPECIFICITY.
      Tissue: Chronic myeloid leukemia cell.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 5).
      Tissue: Cerebellum, Placenta and Thalamus.
    4. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Brain.
    5. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Muscle, Placenta and Testis.
    8. Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiDMTF1_HUMAN
    AccessioniPrimary (citable) accession number: Q9Y222
    Secondary accession number(s): B2RBE1
    , B4DJS5, Q05C48, Q59G79, Q6IS13, Q969T2, Q9H2Z2, Q9H2Z3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 18, 2008
    Last sequence update: November 1, 1999
    Last modified: October 1, 2014
    This is version 118 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3