Q9Y222 (DMTF1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cyclin-D-binding Myb-like transcription factor 1 Short name=hDMTF1 Alternative name(s): Cyclin-D-interacting Myb-like protein 1 Short name=hDMP1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 760 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcriptional activator which activates the CDKN2A/ARF locus in response to Ras-Raf signaling, thereby promoting p53/TP53-dependent growth arrest By similarity. Binds to the consensus sequence 5'-CCCG[GT]ATGT-3' By similarity. Isoform 1 may cooperate with MYB to activate transcription of the ANPEP gene. Isoform 2 may antagonize transcriptional activation by isoform 1. Ref.2 |
| Subunit structure | Interacts with the D-type cyclins CCND1, CCND2 and CCND3 By similarity. Interaction with D-type cyclins may modulate transcriptional activation by this protein By similarity. |
| Subcellular location | |
| Tissue specificity | Expressed at relatively low levels in colonic mucosa, ovary, peripheral leukocytes, prostate and small intestine, and at higher levels in spleen, testis and thymus. Expressed in multiple regions of the brain and CNS including amygdala, caudate, corpus callosum, hippocampus, substantia nigra and subthalamic nucleus. Isoform 1 is the predominant isoform in monocytes, macrophages and neutrophils, isoform 2 is most strongly expressed in peripheral blood leukocytes and quiescent CD34 positive cells, and isoform 3 is expressed at low levels in all hematopoietic cell types. Expression is frequently reduced in non-small-cell lung carcinomas (NSCLC) due to hemizygous gene deletion, strongly suggesting that this locus is haploinsufficient for tumor suppression. Loss of this locus frequently occurs in tumors which retain wild-type CDKN2A/ARF and p53/TP53 loci. Hemizygous gene deletion has also been observed in leukemic blasts from patients with abnormalities of the long arm of chromosome 7. Ref.1 Ref.2 Ref.8 |
| Developmental stage | Isoform 2 expression is down-regulated during myeloid differentiation, while the expression of isoform 1 and isoform 3 remain constant. |
| Post-translational modification | Phosphorylated by the cyclin-D2/CDK4, cyclin-D3/CDK4 and cyclin-D2/CDK6 complexes and to a lesser extent by the cyclin-D1/CDK4 complex By similarity. |
| Sequence similarities | Belongs to the DMTF1 family. Contains 1 HTH myb-type DNA-binding domain. Contains 2 Myb-like domains. |
| Sequence caution | The sequence BAD92467.1 differs from that shown. Reason: Erroneous translation. Wrong choice of frame. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell cycle Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Tumor suppressor |
| Domain | Repeat |
| Ligand | DNA-binding |
| Molecular function | Activator |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell cycle Inferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA nucleusNon-traceable author statement Ref.1. Source: UniProtKB |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW chromatin bindingInferred from electronic annotation. Source: InterPro sequence-specific DNA binding transcription factor activityNon-traceable author statement Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9Y222-1) Also known as: Alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9Y222-2) Also known as: Beta; The sequence of this isoform differs from the canonical sequence as follows: 238-273: LRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNT → QLWTPKKGHTFKLWLSKYCCPQLPNQSNGKKKNEE 274-760: Missing. | ||||||
| Isoform 3 (identifier: Q9Y222-3) Also known as: Gamma; The sequence of this isoform differs from the canonical sequence as follows: 238-285: LRIKHGNDWA...WTEEEEKRLA → KKAIAACFFF...QSNGKKKNEE 286-760: Missing. | ||||||
| Isoform 4 (identifier: Q9Y222-4) The sequence of this isoform differs from the canonical sequence as follows: 37-78: EADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPL → V 238-285: LRIKHGNDWA...WTEEEEKRLA → KKAIAACFFF...QSNGKKKNEE 286-760: Missing. | ||||||
| Isoform 5 (identifier: Q9Y222-5) The sequence of this isoform differs from the canonical sequence as follows: 1-88: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||
Molecule processing | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 760 | 760 | Cyclin-D-binding Myb-like transcription factor 1 | PRO_0000323729 | |||||||||||
Regions | |||||||||||||||
| Domain | 225 – 263 | 39 | Myb-like 1 | ||||||||||||
| Domain | 268 – 333 | 66 | HTH myb-type | ||||||||||||
| Domain | 339 – 388 | 50 | Myb-like 2 | ||||||||||||
| DNA binding | 306 – 329 | 24 | H-T-H motif By similarity | ||||||||||||
| Region | 1 – 237 | 237 | Interaction with CCND2 By similarity | ||||||||||||
| Region | 87 – 458 | 372 | Required for DNA-binding By similarity | ||||||||||||
| Region | 87 – 170 | 84 | Required for transcriptional activation By similarity | ||||||||||||
| Region | 176 – 760 | 585 | Interaction with CCND1, CCND2 and CCND3 By similarity | ||||||||||||
| Region | 459 – 760 | 302 | Required for transcriptional activation By similarity | ||||||||||||
Natural variations | |||||||||||||||
| Alternative sequence | 1 – 88 | 88 | Missing in isoform 5. | VSP_041063 | |||||||||||
| Alternative sequence | 37 – 78 | 42 | EADEI…VALPL → V in isoform 4. | VSP_032089 | |||||||||||
| Alternative sequence | 238 – 285 | 48 | LRIKH…EKRLA → KKAIAACFFFTHRQLWTPKK GHTFKLWLSKYCCPQLPNQS NGKKKNEE in isoform 3 and isoform 4. | VSP_032090 | |||||||||||
| Alternative sequence | 238 – 273 | 36 | LRIKH…DTCNT → QLWTPKKGHTFKLWLSKYCC PQLPNQSNGKKKNEE in isoform 2. | VSP_032091 | |||||||||||
| Alternative sequence | 274 – 760 | 487 | Missing in isoform 2. | VSP_032092 | |||||||||||
| Alternative sequence | 286 – 760 | 475 | Missing in isoform 3 and isoform 4. | VSP_032093 | |||||||||||
| Natural variant | 479 | 1 | V → I. Corresponds to variant rs1558049 [ dbSNP | Ensembl ]. | VAR_039577 | |||||||||||
Experimental info | |||||||||||||||
| Sequence conflict | 345 | 1 | I → T in BAG58937. Ref.3 | ||||||||||||
| Sequence conflict | 616 | 1 | I → V in AAH70064. Ref.7 | ||||||||||||
Secondary structure | |||||||||||||||
Helix Strand Turn | |||||||||||||||
| Helix | 229 – 242 | 14 | |||||||||||||
| Helix | 246 – 253 | 8 | |||||||||||||
| Helix | 257 – 266 | 10 | |||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF084530 mRNA. Translation: AAC33480.1. AF202144 mRNA. Translation: AAG35613.1. AF202145 mRNA. Translation: AAG35614.1. AK296211 mRNA. Translation: BAG58937.1. AK126664 mRNA. No translation available. AK314622 mRNA. Translation: BAG37188.1. AB209230 mRNA. Translation: BAD92467.1. Sequence problems. AC005076 Genomic DNA. Translation: AAD43181.1. CH471091 Genomic DNA. Translation: EAW76963.1. BC007418 mRNA. Translation: AAH07418.2. BC007447 mRNA. Translation: AAH07447.2. BC029370 mRNA. Translation: AAH29370.1. Different termination. BC070064 mRNA. Translation: AAH70064.1. | ||||||||||||
| IPI | IPI00028123. IPI00852885. IPI00887567. IPI00889129. IPI01009399. | ||||||||||||
| RefSeq | NP_001135798.1. NM_001142326.1. NP_001135799.1. NM_001142327.1. NP_066968.3. NM_021145.3. | ||||||||||||
| UniGene | Hs.196129. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9Y222. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9Y222. 2 interactions. | ||||||||||||
| MINT | MINT-1196157. | ||||||||||||
| STRING | 9606.ENSP00000332171. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9Y222. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74762040. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9Y222. | ||||||||||||
| PRIDE | Q9Y222. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000331242; ENSP00000332171; ENSG00000135164. ENST00000394702; ENSP00000378192; ENSG00000135164. ENST00000394703; ENSP00000378193; ENSG00000135164. ENST00000411766; ENSP00000396570; ENSG00000135164. ENST00000412139; ENSP00000407941; ENSG00000135164. ENST00000425406; ENSP00000411908; ENSG00000135164. ENST00000432937; ENSP00000412532; ENSG00000135164. ENST00000447863; ENSP00000389774; ENSG00000135164. ENST00000579677; ENSP00000464596; ENSG00000135164. ENST00000584619; ENSP00000464092; ENSG00000135164. | ||||||||||||
| GeneID | 9988. | ||||||||||||
| KEGG | hsa:9988. | ||||||||||||
| UCSC | uc003uih.3. human. uc003uim.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 9988. | ||||||||||||
| GeneCards | GC07P086781. | ||||||||||||
| H-InvDB | HIX0006815. | ||||||||||||
| HGNC | HGNC:14603. DMTF1. | ||||||||||||
| HPA | HPA023846. | ||||||||||||
| MIM | 608491. gene. | ||||||||||||
| neXtProt | NX_Q9Y222. | ||||||||||||
| PharmGKB | PA27389. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG288590. | ||||||||||||
| HOVERGEN | HBG053416. | ||||||||||||
| InParanoid | Q9Y222. | ||||||||||||
| OMA | ELMNSVM. | ||||||||||||
| OrthoDB | EOG4RJG0Z. | ||||||||||||
| PhylomeDB | Q9Y222. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9Y222. | ||||||||||||
| Bgee | Q9Y222. | ||||||||||||
| CleanEx | HS_DMP1. HS_DMTF1. | ||||||||||||
| Genevestigator | Q9Y222. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.10.60. 2 hits. | ||||||||||||
| InterPro | IPR009057. Homeodomain-like. IPR017877. Myb-like_dom. IPR017930. Myb_dom. IPR001005. SANT/Myb. [Graphical view] | ||||||||||||
| Pfam | PF00249. Myb_DNA-binding. 2 hits. [Graphical view] | ||||||||||||
| SMART | SM00717. SANT. 3 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF46689. Homeodomain_like. 2 hits. | ||||||||||||
| PROSITE | PS51294. HTH_MYB. 1 hit. PS50090. MYB_LIKE. 2 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | DMTF1. human. | ||||||||||||
| GenomeRNAi | 9988. | ||||||||||||
| NextBio | 37719. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | DMTF1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y222 Secondary accession number(s): B2RBE1 Q9H2Z3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
