Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9Y222 (DMTF1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 117. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cyclin-D-binding Myb-like transcription factor 1

Short name=hDMTF1
Alternative name(s):
Cyclin-D-interacting Myb-like protein 1
Short name=hDMP1
Gene names
Name:DMTF1
Synonyms:DMP1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length760 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Transcriptional activator which activates the CDKN2A/ARF locus in response to Ras-Raf signaling, thereby promoting p53/TP53-dependent growth arrest By similarity. Binds to the consensus sequence 5'-CCCG[GT]ATGT-3' By similarity. Isoform 1 may cooperate with MYB to activate transcription of the ANPEP gene. Isoform 2 may antagonize transcriptional activation by isoform 1. Ref.2

Subunit structure

Interacts with the D-type cyclins CCND1, CCND2 and CCND3 By similarity. Interaction with D-type cyclins may modulate transcriptional activation by this protein By similarity.

Subcellular location

Nucleus Ref.8.

Tissue specificity

Expressed at relatively low levels in colonic mucosa, ovary, peripheral leukocytes, prostate and small intestine, and at higher levels in spleen, testis and thymus. Expressed in multiple regions of the brain and CNS including amygdala, caudate, corpus callosum, hippocampus, substantia nigra and subthalamic nucleus. Isoform 1 is the predominant isoform inmonocytes, macrophages and neutrophils, isoform 2 is most strongly expressed in peripheral blood leukocytes and quiescent CD34 positive cells, and isoform 3 is expressed at low levels in all hematopoietic cell types. Expression is frequently reduced in non-small-cell lung carcinomas (NSCLC) due to hemizygous gene deletion, strongly suggesting that this locus is haploinsufficient for tumor suppression. Loss of this locus frequently occurs in tumors which retain wild-type CDKN2A/ARF and p53/TP53 loci. Hemizygous gene deletion has also been observed in leukemic blasts from patients with abnormalities of the long arm of chromosome 7. Ref.1 Ref.2 Ref.8

Developmental stage

Isoform 2 expression is down-regulated during myeloid differentiation, while the expression of isoform 1 and isoform 3 remain constant.

Post-translational modification

Phosphorylated by the cyclin-D2/CDK4, cyclin-D3/CDK4 and cyclin-D2/CDK6 complexes and to a lesser extent by the cyclin-D1/CDK4 complex By similarity.

Sequence similarities

Belongs to the DMTF1 family.

Contains 1 HTH myb-type DNA-binding domain.

Contains 2 Myb-like domains.

Sequence caution

The sequence BAD92467.1 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9Y222-1)

Also known as: Alpha;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9Y222-2)

Also known as: Beta;

The sequence of this isoform differs from the canonical sequence as follows:
     238-273: LRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNT → QLWTPKKGHTFKLWLSKYCCPQLPNQSNGKKKNEE
     274-760: Missing.
Isoform 3 (identifier: Q9Y222-3)

Also known as: Gamma;

The sequence of this isoform differs from the canonical sequence as follows:
     238-285: LRIKHGNDWA...WTEEEEKRLA → KKAIAACFFF...QSNGKKKNEE
     286-760: Missing.
Isoform 4 (identifier: Q9Y222-4)

The sequence of this isoform differs from the canonical sequence as follows:
     37-78: EADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPL → V
     238-285: LRIKHGNDWA...WTEEEEKRLA → KKAIAACFFF...QSNGKKKNEE
     286-760: Missing.
Isoform 5 (identifier: Q9Y222-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-88: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 760760Cyclin-D-binding Myb-like transcription factor 1
PRO_0000323729

Regions

Domain225 – 26339Myb-like 1
Domain268 – 33366HTH myb-type
Domain339 – 38850Myb-like 2
DNA binding306 – 32924H-T-H motif By similarity
Region1 – 237237Interaction with CCND2 By similarity
Region87 – 458372Required for DNA-binding By similarity
Region87 – 17084Required for transcriptional activation By similarity
Region176 – 760585Interaction with CCND1, CCND2 and CCND3 By similarity
Region459 – 760302Required for transcriptional activation By similarity

Natural variations

Alternative sequence1 – 8888Missing in isoform 5.
VSP_041063
Alternative sequence37 – 7842EADEI…VALPL → V in isoform 4.
VSP_032089
Alternative sequence238 – 28548LRIKH…EKRLA → KKAIAACFFFTHRQLWTPKK GHTFKLWLSKYCCPQLPNQS NGKKKNEE in isoform 3 and isoform 4.
VSP_032090
Alternative sequence238 – 27336LRIKH…DTCNT → QLWTPKKGHTFKLWLSKYCC PQLPNQSNGKKKNEE in isoform 2.
VSP_032091
Alternative sequence274 – 760487Missing in isoform 2.
VSP_032092
Alternative sequence286 – 760475Missing in isoform 3 and isoform 4.
VSP_032093
Natural variant4791V → I.
Corresponds to variant rs1558049 [ dbSNP | Ensembl ].
VAR_039577

Experimental info

Sequence conflict3451I → T in BAG58937. Ref.3
Sequence conflict6161I → V in AAH70064. Ref.7

Secondary structure

....... 760
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Alpha) [UniParc].

Last modified November 1, 1999. Version 1.
Checksum: 57B3AE332F21A333

FASTA76084,471
        10         20         30         40         50         60 
MSTVEEDSDT VTVETVNSVT LTQDTEGNLI LHCPQNEADE IDSEDSIEPP HKRLCLSSED 

        70         80         90        100        110        120 
DQSIDDSTPC ISVVALPLSE NDQSFEVTMT ATTEVADDEV TEGTVTQIQI LQNEQLDEIS 

       130        140        150        160        170        180 
PLGNEEVSAV SQAWFTTKED KDSLTNKGHK WKQGMWSKEE IDILMNNIER YLKARGIKDA 

       190        200        210        220        230        240 
TEIIFEMSKD ERKDFYRTIA WGLNRPLFAV YRRVLRMYDD RNHVGKYTPE EIEKLKELRI 

       250        260        270        280        290        300 
KHGNDWATIG AALGRSASSV KDRCRLMKDT CNTGKWTEEE EKRLAEVVHE LTSTEPGDIV 

       310        320        330        340        350        360 
TQGVSWAAVA ERVGTRSEKQ CRSKWLNYLN WKQSGGTEWT KEDEINLILR IAELDVADEN 

       370        380        390        400        410        420 
DINWDLLAEG WSSVRSPQWL RSKWWTIKRQ IANHKDVSFP VLIKGLKQLH ENQKNNPTLL 

       430        440        450        460        470        480 
ENKSGSGVPN SNTNSSVQHV QIRVARLEDN TAISSSPMAA LQIPVQITHV SSADSPATVD 

       490        500        510        520        530        540 
SETITLNSGT LQTFEILPSF HLQPTGTPGT YLLQTSSSQG LPLTLTASPT VTLTAAAPAS 

       550        560        570        580        590        600 
PEQIIVHALS PEHLLNTSDN VTVQCHTPRV IIQTVATEDI TSSISQAELT VDSDIQSSDF 

       610        620        630        640        650        660 
PEPPDALEAD TFPDEIHHPK MTVEPSFNDA HVSKFSDQNS TELMNSVMVR TEEEISDTDL 

       670        680        690        700        710        720 
KQEESPSDLA SAYVTEGLES PTIEEQVDQT IDDETILIVP SPHGFIQASD VIDTESVLPL 

       730        740        750        760 
TTLTDPILQH HQEESNIIGS SLGSPVSEDS KDVEDLVNCH 

« Hide

Isoform 2 (Beta) [UniParc].

Checksum: 0D3F2715231DAED9
Show »

FASTA27231,227
Isoform 3 (Gamma) [UniParc].

Checksum: 0DBCC4F2345C48BF
Show »

FASTA28532,749
Isoform 4 [UniParc].

Checksum: 59F912F2CC8082E7
Show »

FASTA24428,296
Isoform 5 [UniParc].

Checksum: 818B4CFA4326350C
Show »

FASTA67274,878

References

« Hide 'large scale' references
[1]"Cloning and chromosomal localization of the gene encoding human cyclin D-binding Myb-like protein (hDMP1)."
Bodner S.M., Naeve C.W., Rakestraw K.M., Jones B.G., Valentine V.A., Valentine M.B., Luthardt F.W., Willman C.L., Raimondi S.C., Downing J.R., Roussel M.F., Sherr C.J., Look A.T.
Gene 229:223-228(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
[2]"Alternative splicing of the human cyclin D-binding Myb-like protein (hDMP1) yields a truncated protein isoform that alters macrophage differentiation patterns."
Tschan M.P., Fischer K.M., Fung V.S., Pirnia F., Borner M.M., Fey M.F., Tobler A., Torbett B.E.
J. Biol. Chem. 278:42750-42760(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, TISSUE SPECIFICITY.
Tissue: Chronic myeloid leukemia cell.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 5).
Tissue: Cerebellum, Placenta and Thalamus.
[4]Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Brain.
[5]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Muscle, Placenta and Testis.
[8]"Mutually exclusive inactivation of DMP1 and ARF/p53 in lung cancer."
Mallakin A., Sugiyama T., Taneja P., Matise L.A., Frazier D.P., Choudhary M., Hawkins G.A., D'Agostino R.B. Jr., Willingham M.C., Inoue K.
Cancer Cell 12:381-394(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF084530 mRNA. Translation: AAC33480.1.
AF202144 mRNA. Translation: AAG35613.1.
AF202145 mRNA. Translation: AAG35614.1.
AK296211 mRNA. Translation: BAG58937.1.
AK126664 mRNA. No translation available.
AK314622 mRNA. Translation: BAG37188.1.
AB209230 mRNA. Translation: BAD92467.1. Sequence problems.
AC005076 Genomic DNA. Translation: AAD43181.1.
CH471091 Genomic DNA. Translation: EAW76963.1.
BC007418 mRNA. Translation: AAH07418.2.
BC007447 mRNA. Translation: AAH07447.2.
BC029370 mRNA. Translation: AAH29370.1. Different termination.
BC070064 mRNA. Translation: AAH70064.1.
CCDSCCDS47633.1. [Q9Y222-5]
CCDS5601.1. [Q9Y222-1]
RefSeqNP_001135798.1. NM_001142326.1. [Q9Y222-5]
NP_001135799.1. NM_001142327.1. [Q9Y222-1]
NP_066968.3. NM_021145.3. [Q9Y222-1]
XP_005250791.1. XM_005250734.2. [Q9Y222-1]
XP_006716265.1. XM_006716202.1. [Q9Y222-1]
UniGeneHs.196129.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2LLKNMR-A220-274[»]
ProteinModelPortalQ9Y222.
SMRQ9Y222. Positions 220-344.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115309. 2 interactions.
IntActQ9Y222. 3 interactions.
MINTMINT-1196157.
STRING9606.ENSP00000332171.

PTM databases

PhosphoSiteQ9Y222.

Polymorphism databases

DMDM74762040.

Proteomic databases

MaxQBQ9Y222.
PaxDbQ9Y222.
PRIDEQ9Y222.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000331242; ENSP00000332171; ENSG00000135164. [Q9Y222-1]
ENST00000394702; ENSP00000378192; ENSG00000135164. [Q9Y222-3]
ENST00000394703; ENSP00000378193; ENSG00000135164. [Q9Y222-1]
ENST00000411766; ENSP00000396570; ENSG00000135164. [Q9Y222-4]
ENST00000412139; ENSP00000407941; ENSG00000135164. [Q9Y222-2]
ENST00000425406; ENSP00000411908; ENSG00000135164. [Q9Y222-4]
ENST00000432937; ENSP00000412532; ENSG00000135164. [Q9Y222-5]
ENST00000447863; ENSP00000389774; ENSG00000135164. [Q9Y222-3]
ENST00000579677; ENSP00000464596; ENSG00000135164. [Q9Y222-2]
ENST00000584619; ENSP00000464092; ENSG00000135164. [Q9Y222-2]
GeneID9988.
KEGGhsa:9988.
UCSCuc003uih.3. human. [Q9Y222-1]
uc003uim.1. human. [Q9Y222-2]

Organism-specific databases

CTD9988.
GeneCardsGC07P086781.
H-InvDBHIX0006815.
HGNCHGNC:14603. DMTF1.
HPAHPA023846.
MIM608491. gene.
neXtProtNX_Q9Y222.
PharmGKBPA27389.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG288590.
HOVERGENHBG053416.
InParanoidQ9Y222.
OMATDPILQH.
OrthoDBEOG7QZG92.
PhylomeDBQ9Y222.
TreeFamTF333537.

Gene expression databases

ArrayExpressQ9Y222.
BgeeQ9Y222.
CleanExHS_DMP1.
HS_DMTF1.
GenevestigatorQ9Y222.

Family and domain databases

Gene3D1.10.10.60. 2 hits.
InterProIPR009057. Homeodomain-like.
IPR017877. Myb-like_dom.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
[Graphical view]
PfamPF00249. Myb_DNA-binding. 2 hits.
[Graphical view]
SMARTSM00717. SANT. 3 hits.
[Graphical view]
SUPFAMSSF46689. SSF46689. 3 hits.
PROSITEPS51294. HTH_MYB. 1 hit.
PS50090. MYB_LIKE. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSDMTF1. human.
GeneWikiDMTF1.
GenomeRNAi9988.
NextBio37719.
PROQ9Y222.
SOURCESearch...

Entry information

Entry nameDMTF1_HUMAN
AccessionPrimary (citable) accession number: Q9Y222
Secondary accession number(s): B2RBE1 expand/collapse secondary AC list , B4DJS5, Q05C48, Q59G79, Q6IS13, Q969T2, Q9H2Z2, Q9H2Z3
Entry history
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: November 1, 1999
Last modified: July 9, 2014
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM