Q9Y215 (COLQ_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Acetylcholinesterase collagenic tail peptide Alternative name(s): AChE Q subunit Acetylcholinesterase-associated collagen | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 455 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Anchors the catalytic subunits of asymmetric AChE to the synaptic basal lamina. |
| Subunit structure | Homotrimer. Component of the asymmetric form of AChE, a disulfide-bonded oligomer composed of the collagenic subunits (Q) and a variable number of asymmetric catalytic subunits (T). The N-terminal of a collagenic subunit (Q) associates with the C-terminal of a catalytic subunit (T). |
| Subcellular location | |
| Tissue specificity | Found at the end plate of skeletal muscle. |
| Domain | The proline-rich attachment domain (PRAD) binds the AChE catalytic subunits. |
| Post-translational modification | The triple-helical tail is stabilized by disulfide bonds at each end. |
| Involvement in disease | Defects in COLQ are the cause of congenital myasthenic syndrome Engel type (CMSE) [MIM:603034]; also known as end-plate acetylcholinesterase deficiency or congenital myasthenic syndrome type IC (CMS-IC). CMSE is a rare autosomal recessive congenital myasthenic syndrome characterized by onset during childhood, generalized weakness, abnormal fatigability on exertion, refrectoriness to acetylcholinesterase drugs, decremental electromyographic response and morphological abnormalities of the neuromuscular junctions. Ref.1 Ref.9 |
| Sequence similarities | Belongs to the COLQ family. Contains 2 collagen-like domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Neurotransmitter degradation |
| Cellular component | Cell junction Synapse |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Congenital myasthenic syndrome Disease mutation |
| Domain | Collagen Repeat Signal |
| PTM | Disulfide bond |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | acetylcholine catabolic process in synaptic cleft Traceable author statement. Source: ProtInc asymmetric protein localizationTraceable author statement. Source: ProtInc |
| Cellular component | basal lamina Traceable author statement. Source: ProtInc cell junctionInferred from electronic annotation. Source: UniProtKB-KW collagenInferred from electronic annotation. Source: UniProtKB-KW extracellular spaceTraceable author statement. Source: ProtInc synaptic cleftTraceable author statement Ref.2. Source: GOC |
| Molecular function | protein binding Inferred from physical interaction Ref.8. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ACHE | P22303 | 2 | EBI-1637847,EBI-1637793 |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform I (identifier: Q9Y215-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform II (identifier: Q9Y215-2) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MVVLNPMTLGIYLQLFFLSIVSQPTFINSVLPISA → MTGSSFSLAHLLIISGLLCYSAGCL | ||||||
| Isoform III (identifier: Q9Y215-3) The sequence of this isoform differs from the canonical sequence as follows: 74-107: Missing. | ||||||
| Isoform IV (identifier: Q9Y215-4) The sequence of this isoform differs from the canonical sequence as follows: 73-76: Missing. | ||||||
| Isoform V (identifier: Q9Y215-5) The sequence of this isoform differs from the canonical sequence as follows: 124-132: Missing. | ||||||
| Isoform VI (identifier: Q9Y215-6) The sequence of this isoform differs from the canonical sequence as follows: 240-291: GQKGDSGVMG...RGFPGPPGRC → SSRTPCTLPR...DYISSGTERG 292-455: Missing. | ||||||
| Isoform VII (identifier: Q9Y215-7) The sequence of this isoform differs from the canonical sequence as follows: 272-281: GQLIMGPKGE → DFCGQQPGGA 282-455: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform VIII (identifier: Q9Y215-8) The sequence of this isoform differs from the canonical sequence as follows: 273-329: QLIMGPKGER...FVVNNQEELE → HMETCNAPST...VLAPSPPTFV 330-455: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | Potential | ||||||
| Chain | 23 – 455 | 433 | Acetylcholinesterase collagenic tail peptide | PRO_0000005854 | |||||
Regions | |||||||||
| Domain | 96 – 269 | 174 | Collagen-like 1 | ||||||
| Domain | 277 – 291 | 15 | Collagen-like 2 | ||||||
| Region | 51 – 67 | 17 | PRAD | ||||||
| Region | 130 – 133 | 4 | Heparan sulfate proteoglycan binding Potential | ||||||
| Region | 235 – 238 | 4 | Heparan sulfate proteoglycan binding Potential | ||||||
Amino acid modifications | |||||||||
| Disulfide bond | 51 | Interchain (with T subunit) Potential | |||||||
| Disulfide bond | 52 | Interchain (with T subunit) Potential | |||||||
| Disulfide bond | 93 | Interchain Potential | |||||||
| Disulfide bond | 291 | Interchain Potential | |||||||
| Disulfide bond | 293 | Interchain Potential | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 35 | 35 | MVVLN…LPISA → MTGSSFSLAHLLIISGLLCY SAGCL in isoform II. | VSP_001175 | |||||
| Alternative sequence | 73 – 76 | 4 | Missing in isoform IV. | VSP_001176 | |||||
| Alternative sequence | 74 – 107 | 34 | Missing in isoform III. | VSP_001177 | |||||
| Alternative sequence | 124 – 132 | 9 | Missing in isoform V. | VSP_001178 | |||||
| Alternative sequence | 240 – 291 | 52 | GQKGD…PPGRC → SSRTPCTLPRRPPVPCGQGS RSPVTVVAGNESQACLLPRF EEDYISSGTERG in isoform VI. | VSP_001179 | |||||
| Alternative sequence | 272 – 281 | 10 | GQLIMGPKGE → DFCGQQPGGA in isoform VII. | VSP_001180 | |||||
| Alternative sequence | 273 – 329 | 57 | QLIMG…QEELE → HMETCNAPSTATSTPRPAAT SPEGREEKVGCAPQNWQQLL HCHQTGHVLAPSPPTFV in isoform VIII. | VSP_001181 | |||||
| Alternative sequence | 282 – 455 | 174 | Missing in isoform VII. | VSP_001182 | |||||
| Alternative sequence | 292 – 455 | 164 | Missing in isoform VI. | VSP_001183 | |||||
| Alternative sequence | 330 – 455 | 126 | Missing in isoform VIII. | VSP_001184 | |||||
| Natural variant | 59 | 1 | P → Q in CMSE; abrogates binding to T subunit. Ref.9 | VAR_010133 | |||||
| Natural variant | 312 | 1 | S → G. Corresponds to variant rs6782980 [ dbSNP | Ensembl ]. | VAR_048809 | |||||
| Natural variant | 342 | 1 | D → E in CMSE; impairs anchoring to the basal lamina. Ref.9 | VAR_010134 | |||||
| Natural variant | 410 | 1 | R → Q in CMSE. Ref.9 | VAR_010135 | |||||
| Natural variant | 430 | 1 | Y → S in CMSE. Ref.1 | VAR_010136 | |||||
| Natural variant | 444 | 1 | C → Y in CMSE. Ref.9 | VAR_010137 | |||||
Experimental info | |||||||||
| Sequence conflict | 370 | 1 | D → N in AAO06818. Ref.3 | ||||||
| Sequence conflict | 399 | 1 | R → RD in CAA12648. Ref.1 | ||||||
| Sequence conflict | 399 | 1 | R → RD in AAO06814. Ref.3 | ||||||
| Sequence conflict | 399 | 1 | R → RD in AAO06816. Ref.3 | ||||||
| Sequence conflict | 399 | 1 | R → RD in AAO06817. Ref.3 | ||||||
| Sequence conflict | 399 | 1 | R → RD in AAO06818. Ref.3 | ||||||
| Sequence conflict | 399 | 1 | R → RD in AAO06819. Ref.3 | ||||||
| Sequence conflict | 400 | 1 | C → Y in AAO06816. Ref.3 | ||||||
| Sequence conflict | 404 | 1 | Y → D in AAO06817. Ref.3 | ||||||
| Sequence conflict | 423 | 1 | G → V in AAO06819. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mutation in the human acetylcholinesterase-associated collagen gene, COLQ, is responsible for congenital myasthenic syndrome with end-plate acetylcholinesterase deficiency (Type Ic)." Donger C., Krejci E., Serradell A.P., Eymard B., Bon S., Nicole S., Chateau D., Gary F., Fardeau M., Massoulie J., Guicheney P. Am. J. Hum. Genet. 63:967-975(1998) [PubMed: 9758617] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT CMSE SER-430. Tissue: Blood and Skeletal muscle. |
| [2] | "Human endplate acetylcholinesterase deficiency caused by mutations in the collagen-like tail subunit (ColQ) of the asymmetric enzyme." Ohno K., Brengman J., Tsujino A., Engel A.G. Proc. Natl. Acad. Sci. U.S.A. 95:9654-9659(1998) [PubMed: 9689136] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING. Tissue: Skeletal muscle. |
| [3] | Arredondo J., DeLeon M. Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM II). Tissue: Thymus. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Lung. |
| [7] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [8] | "The synaptic acetylcholinesterase tetramer assembles around a polyproline II helix." Dvir H., Harel M., Bon S., Liu W.-Q., Vidal M., Garbay C., Sussman J.L., Massoulie J., Silman I. EMBO J. 23:4394-4405(2004) [PubMed: 15526038] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.35 ANGSTROMS) OF 53-67 IN COMPLEX WITH ACHE. |
| [9] | "The spectrum of mutations causing end-plate acetylcholinesterase deficiency." Ohno K., Engel A.G., Brengman J.M., Shen X.-M., Heidenreich F., Vincent A., Milone M., Tan E., Demirci M., Walsh P., Nakano S., Akiguchi I. Ann. Neurol. 47:162-170(2000) [PubMed: 10665486] [Abstract] Cited for: VARIANTS CMSE GLN-59; GLU-342; GLN-410 AND TYR-444. Tissue: Blood and Muscle. |
Web resources
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AJ225895 mRNA. Translation: CAA12648.1. AF057036 mRNA. Translation: AAC39927.1. AF229126 AF229125 Genomic DNA. Translation: AAF43195.1.AF229126 AF229125 Genomic DNA. Translation: AAF43196.1.AF229126 AF229125 Genomic DNA. Translation: AAF43197.1.AF229126 AF229125 Genomic DNA. Translation: AAF43198.1.AF229126 AF229125 Genomic DNA. Translation: AAF43199.1.AF229122 AF229121 Genomic DNA. Translation: AAF43200.1.AF229124 AF229122 Genomic DNA. Translation: AAF43201.1.AF229126 AF229122 Genomic DNA. Translation: AAF43202.1.AY150334 mRNA. Translation: AAO06814.1. AY150336 mRNA. Translation: AAO06816.1. AY150337 mRNA. Translation: AAO06817.1. AY150338 mRNA. Translation: AAO06818.1. AY150339 mRNA. Translation: AAO06819.1. AK128401 mRNA. Translation: BAG54671.1. CH471055 Genomic DNA. Translation: EAW64250.1. BC074828 mRNA. Translation: AAH74828.1. BC074829 mRNA. Translation: AAH74829.1. | ||||||||||||
| IPI | IPI00031687. IPI00220970. IPI00220971. IPI00220972. IPI00220973. IPI00220974. IPI00220976. IPI00334651. | ||||||||||||
| RefSeq | NP_005668.2. NM_005677.3. NP_536799.1. NM_080538.2. NP_536800.2. NM_080539.3. | ||||||||||||
| UniGene | Hs.146735. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9Y215. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9Y215. 1 interaction. | ||||||||||||
| STRING | Q9Y215. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 116241309. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9Y215. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000383788; ENSP00000373298; ENSG00000206561. | ||||||||||||
| GeneID | 8292. | ||||||||||||
| KEGG | hsa:8292. | ||||||||||||
| UCSC | uc003bzv.1. human. uc003bzx.1. human. uc003bzz.1. human. uc003cab.1. human. uc010heo.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 8292. | ||||||||||||
| GeneCards | GC03M015491. | ||||||||||||
| H-InvDB | HIX0024278. | ||||||||||||
| HGNC | HGNC:2226. COLQ. | ||||||||||||
| MIM | 603033. gene. 603034. phenotype. | ||||||||||||
| neXtProt | NX_Q9Y215. | ||||||||||||
| Orphanet | 98915. Synaptic congenital myasthenic syndromes. | ||||||||||||
| PharmGKB | PA26743. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG04078. | ||||||||||||
| GeneTree | ENSGT00530000064304. | ||||||||||||
| HOVERGEN | HBG102052. | ||||||||||||
| InParanoid | Q9Y215. | ||||||||||||
| OMA | KDDANTV. | ||||||||||||
| OrthoDB | EOG4Z36F5. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9Y215. | ||||||||||||
| Bgee | Q9Y215. | ||||||||||||
| Genevestigator | Q9Y215. | ||||||||||||
| GermOnline | ENSG00000206561. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR008160. Collagen. IPR011936. Myxo_disulph_rpt. [Graphical view] | ||||||||||||
| Pfam | PF01391. Collagen. 1 hit. [Graphical view] | ||||||||||||
| TIGRFAMs | TIGR02232. Myxo_disulf_rpt. 1 hit. | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 31075. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | COLQ_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9Y215 Secondary accession number(s): B3KY09 Q9UP88 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with