Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9XZI6 (PICAL_CAEEL) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 101. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Phosphatidylinositol-binding clathrin assembly protein unc-11
Alternative name(s):
AP180-like adaptor protein
Uncoordinated protein 11
Gene names
Name:unc-11
ORF Names:C32E8.10
OrganismCaenorhabditis elegans [Reference proteome]
Taxonomic identifier6239 [NCBI]
Taxonomic lineageEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis

Protein attributes

Sequence length586 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Assembly protein recruiting clathrin and adaptor protein complex 2 (AP2) to cell membranes at sites of coated-pit formation and clathrin-vesicle assembly. May be required to determine the amount of membrane to be recycled, possibly by regulating the size of the clathrin cage. Involved in AP2-dependent clathrin-mediated endocytosis at the neuromuscular junction. Required for the efficient targeting of the synaptic vesicle protein synaptobrevin. Ref.1

Subunit structure

Binds clathrin and phosphatidylinositol 4,5-bisphosphate By similarity.

Subcellular location

Membraneclathrin-coated pit. Golgi apparatus. Cytoplasmic vesicleclathrin-coated vesicle. Note: Colocalized with clathrin in the Golgi area. Ref.1

Tissue specificity

High levels in the nervous system and at lower levels in other tissues. In neurons, enriched at presynaptic terminals and is also present in cell bodies. Ref.1

Sequence similarities

Belongs to the PICALM/SNAP91 family.

Contains 1 ENTH (epsin N-terminal homology) domain.

Ontologies

Binary interactions

Alternative products

This entry describes 9 isoforms produced by alternative splicing. [Align] [Select]
Isoform A Ref.1 (identifier: Q9XZI6-1)

Also known as: a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform B Ref.1 (identifier: Q9XZI6-2)

Also known as: h;

The sequence of this isoform differs from the canonical sequence as follows:
     419-458: Missing.
     489-489: G → GYR
Isoform C Ref.1 (identifier: Q9XZI6-3)

Also known as: b;

The sequence of this isoform differs from the canonical sequence as follows:
     419-458: Missing.
Isoform c (identifier: Q9XZI6-7)

The sequence of this isoform differs from the canonical sequence as follows:
     459-459: N → NEPENPFITAPAAPQMHNAPPVPPPPASQGAPAPINPFADPSATAASSAQPFGDPDDFKFEQKNVKIKILIP
Note: No experimental confirmation available.
Isoform D Ref.1 (identifier: Q9XZI6-4)

The sequence of this isoform differs from the canonical sequence as follows:
     397-449: Missing.
     489-489: G → GYR
Isoform d (identifier: Q9XZI6-8)

The sequence of this isoform differs from the canonical sequence as follows:
     397-408: APQTADVTNPFG → LLQCNRKLQMVS
     409-460: Missing.
Note: No experimental confirmation available.
Isoform E Ref.1 (identifier: Q9XZI6-5)

The sequence of this isoform differs from the canonical sequence as follows:
     383-512: Missing.
Isoform e (identifier: Q9XZI6-9)

The sequence of this isoform differs from the canonical sequence as follows:
     383-467: QPDLLDMFQS...PNGHQAAPFG → HQCIRLQWEC...LVVYFSLSLS
     468-586: Missing.
Note: No experimental confirmation available.
Isoform f (identifier: Q9XZI6-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-388: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 586586Phosphatidylinositol-binding clathrin assembly protein unc-11
PRO_0000187065

Regions

Domain29 – 161133ENTH

Natural variations

Alternative sequence1 – 388388Missing in isoform f.
VSP_050679
Alternative sequence383 – 512130Missing in isoform E. Ref.1
VSP_050680
Alternative sequence383 – 46785QPDLL…AAPFG → HQCIRLQWECINNHLVLSQC GILRWQHTVNNMDTDNLFHH NSNTKFNWFMQRWLQRTLHK LNRPRPPQPIHLDYSLVVYF SLSLS in isoform e.
VSP_020098
Alternative sequence397 – 44953Missing in isoform D. Ref.1
VSP_050681
Alternative sequence397 – 40812APQTA…TNPFG → LLQCNRKLQMVS in isoform d.
VSP_020099
Alternative sequence409 – 46052Missing in isoform d.
VSP_020100
Alternative sequence419 – 45840Missing in isoform C and isoform B. Ref.1
VSP_050682
Alternative sequence4591N → NEPENPFITAPAAPQMHNAP PVPPPPASQGAPAPINPFAD PSATAASSAQPFGDPDDFKF EQKNVKIKILIP in isoform c.
VSP_020101
Alternative sequence468 – 586119Missing in isoform e.
VSP_020102
Alternative sequence4891G → GYR in isoform B and isoform D. Ref.1
VSP_050683

Sequences

Sequence LengthMass (Da)Tools
Isoform A (a) [UniParc].

Last modified November 1, 1999. Version 1.
Checksum: 6E337A81D302DD81

FASTA58664,064
        10         20         30         40         50         60 
MQTIEKALHQ PMPFTTGGQT ISDRLTAAKH SLAGSQLGKT ICKATTEEVM APKKKHLDYL 

        70         80         90        100        110        120 
LHCTNEPNVS IPSMANLLIE RTQNPNWTVV YKALITIHNI MCYGNERFSQ YLASCNTTFN 

       130        140        150        160        170        180 
LTAFVDKVGG AGGYDMSTHV RRYAKYIGEK INTYRMCAFD FCKVKRGRED GLLRTMHTDK 

       190        200        210        220        230        240 
LLKTIPILQN QIDALLEFSV TTSELNNGVI NCSFILLFRD LIRLFACYND GIINVLEKYF 

       250        260        270        280        290        300 
DMNKKQCRDA LDTYKSFLTR LDKVAEFLRV AESVGIDRGE IPDLTRAPAS LLEALEAHLI 

       310        320        330        340        350        360 
HLEGGKAPPP TQQHVAPHQF TTGFAFSQQP QPALGDAERQ RYIELEQERL RQFEDQKKSI 

       370        380        390        400        410        420 
NSANPFANDV ASAAPAPATS AAQPDLLDMF QSSAAPAPQT ADVTNPFGNF AAPSAFPTNV 

       430        440        450        460        470        480 
PPPAAHSAPF GVQPAPQHSA APFYANLHQA PPMQSQAPNG HQAAPFGYPN AHPDDLARMT 

       490        500        510        520        530        540 
AQMSLNQQGA PAGWNTTTSA VSNNPFGATS APQPMYTAPM GMYQQPFGAQ PMWNPAMAAY 

       550        560        570        580 
GQQYGYGQPV PPQQQHQIQL VHAAMAAKNA AQAQQAQAAS ADPFGL 

« Hide

Isoform B (h) [UniParc].

Checksum: 8641691EF297D717
Show »

FASTA54860,273
Isoform C (b) [UniParc].

Checksum: 69D424C56BAF517A
Show »

FASTA54659,954
Isoform c [UniParc].

Checksum: 891BA9FB3525AAD2
Show »

FASTA65771,443
Isoform D [UniParc].

Checksum: 7EB8FC25A2896AA5
Show »

FASTA53558,978
Isoform d [UniParc].

Checksum: 4FDEE1FAEDBA4847
Show »

FASTA53458,994
Isoform E [UniParc].

Checksum: 44EDE64136212A9E
Show »

FASTA45650,727
Isoform e [UniParc].

Checksum: 42042675FC806DA9
Show »

FASTA46753,131
Isoform f [UniParc].

Checksum: 2F38F15C93F0F0C1
Show »

FASTA19820,632

References

« Hide 'large scale' references
[1]"UNC-11, a Caenorhabditis elegans AP180 homologue, regulates the size and protein composition of synaptic vesicles."
Nonet M.L., Holgado A.M., Brewer F., Serpe C.J., Norbeck B.A., Holleran J., Wei L., Hartwieg E., Jorgensen E.M., Alfonso A.
Mol. Biol. Cell 10:2343-2360(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D AND E), FUNCTION, SUBCELLULAR LOCATION.
Strain: Bristol N2.
[2]"Genome sequence of the nematode C. elegans: a platform for investigating biology."
The C. elegans sequencing consortium
Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
Strain: Bristol N2.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF144257 mRNA. Translation: AAD37365.1.
AF144258 mRNA. Translation: AAD37366.1.
AF144259 mRNA. Translation: AAD37367.1.
AF144260 mRNA. Translation: AAD37368.1.
AF144261 mRNA. Translation: AAD37369.1.
AF144262 mRNA. Translation: AAD37370.1.
FO080749 Genomic DNA. Translation: CCD66409.1.
FO080749 Genomic DNA. Translation: CCD66410.1.
FO080749 Genomic DNA. Translation: CCD66411.1.
FO080749 Genomic DNA. Translation: CCD66412.1.
FO080749 Genomic DNA. Translation: CCD66413.1.
FO080749 Genomic DNA. Translation: CCD66414.1.
FO080749 Genomic DNA. Translation: CCD66415.1.
RefSeqNP_001021014.1. NM_001025843.2. [Q9XZI6-3]
NP_001021015.1. NM_001025844.1. [Q9XZI6-9]
NP_001021016.1. NM_001025845.2. [Q9XZI6-2]
NP_491227.1. NM_058826.1.
NP_491228.1. NM_058827.3. [Q9XZI6-7]
NP_491229.1. NM_058828.1. [Q9XZI6-8]
NP_491230.1. NM_058829.3. [Q9XZI6-6]
UniGeneCel.16650.

3D structure databases

ProteinModelPortalQ9XZI6.
SMRQ9XZI6. Positions 37-302.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid37426. 3 interactions.
DIPDIP-25315N.
IntActQ9XZI6. 7 interactions.
MINTMINT-1053765.

Proteomic databases

PaxDbQ9XZI6.
PRIDEQ9XZI6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaC32E8.10a; C32E8.10a; WBGene00006751. [Q9XZI6-1]
GeneID171952.
KEGGcel:CELE_C32E8.10.
UCSCC32E8.10f. c. elegans. [Q9XZI6-1]

Organism-specific databases

CTD171952.
WormBaseC32E8.10a; CE23562; WBGene00006751; unc-11.
C32E8.10b; CE27812; WBGene00006751; unc-11.
C32E8.10c; CE24822; WBGene00006751; unc-11.
C32E8.10d; CE23564; WBGene00006751; unc-11.
C32E8.10e; CE23565; WBGene00006751; unc-11.
C32E8.10f; CE23566; WBGene00006751; unc-11.
C32E8.10h; CE27813; WBGene00006751; unc-11.

Phylogenomic databases

eggNOGNOG267212.
GeneTreeENSGT00390000008805.
InParanoidQ9XZI6.
OMAITIHNIM.
OrthoDBEOG76QFM8.
PhylomeDBQ9XZI6.

Family and domain databases

Gene3D1.20.58.150. 1 hit.
1.25.40.90. 1 hit.
InterProIPR014712. Clathrin_Pinositid-bd_GAT-like.
IPR008942. ENTH_VHS.
IPR013809. Epsin-like_N.
IPR001026. Epsin_dom_N.
[Graphical view]
PfamPF01417. ENTH. 1 hit.
[Graphical view]
SMARTSM00273. ENTH. 1 hit.
[Graphical view]
SUPFAMSSF48464. SSF48464. 1 hit.
PROSITEPS50942. ENTH. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio873385.

Entry information

Entry namePICAL_CAEEL
AccessionPrimary (citable) accession number: Q9XZI6
Secondary accession number(s): Q95Q72 expand/collapse secondary AC list , Q95Q73, Q95Q74, Q95Q75, Q9UA04, Q9UA05, Q9XZI7, Q9XZI8, Q9XZI9
Entry history
Integrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: November 1, 1999
Last modified: July 9, 2014
This is version 101 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Relevant documents

SIMILARITY comments

Index of protein domains and families

Caenorhabditis elegans

Caenorhabditis elegans: entries, gene names and cross-references to WormBase