Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2

Gene

Magi2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Seems to act as scaffold molecule at synaptic junctions by assembling neurotransmitter receptors and cell adhesion proteins. Plays a role in nerve growth factor (NGF)-induced recruitment of RAPGEF2 to late endosomes and neurite outgrowth. May play a role in regulating activin-mediated signaling in neuronal cells. Enhances the ability of PTEN to suppress AKT1 activation (By similarity).By similarity

GO - Molecular functioni

  • beta-1 adrenergic receptor binding Source: UniProtKB
  • phosphatase binding Source: UniProtKB
  • receptor signaling complex scaffold activity Source: UniProtKB
  • signal transducer activity Source: MGI
  • SMAD binding Source: UniProtKB
  • type II activin receptor binding Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processNeurogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
Alternative name(s):
Activin receptor-interacting protein 1
Short name:
Acvrip1
Atrophin-1-interacting protein 1
Short name:
AIP-1
Membrane-associated guanylate kinase inverted 2
Short name:
MAGI-2
Gene namesi
Name:Magi2
Synonyms:Acvrinp1, Aip1, Arip1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1354953 Magi2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Endosome, Membrane, Synapse, Synaptosome

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945871 – 1275Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2Add BLAST1275

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei361PhosphotyrosineCombined sources1
Modified residuei685PhosphoserineBy similarity1
Modified residuei826PhosphotyrosineCombined sources1
Modified residuei883PhosphoserineBy similarity1
Modified residuei884PhosphoserineBy similarity1
Modified residuei1013PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9WVQ1
PeptideAtlasiQ9WVQ1
PRIDEiQ9WVQ1

PTM databases

iPTMnetiQ9WVQ1
PhosphoSitePlusiQ9WVQ1

Expressioni

Tissue specificityi

Specifically expressed in brain.

Gene expression databases

BgeeiENSMUSG00000040003
ExpressionAtlasiQ9WVQ1 baseline and differential
GenevisibleiQ9WVQ1 MM

Interactioni

Subunit structurei

Interacts (via its WW domains) with DRPLA (By similarity). Interacts (via its second PDZ domain) with PTEN (via unphosphorylated C-terminus); this interaction diminishes the degradation rate of PTEN (By similarity). Interacts (via guanylate kinase domain) with DLGAP1 (By similarity). Interacts (via the PDZ domains) with GRIN2A, GRID2 and NLGN1 (By similarity). Interacts with CTNND2, CTNNB1 and MAGUIN-1 (By similarity). Interacts with ACVR2A, SMAD2 and SMAD3 (PubMed:10681527). Part of a complex consisting of AIP1, ACVR2A, ACVR1B and SMAD3 (PubMed:10681527). May interact with HTR2A (PubMed:14988405). Interacts with RAPGEF2 (By similarity). Identified in a complex with ACTN4, CASK, IQGAP1, NPHS1, SPTAN1 and SPTBN1 (By similarity). Interacts with DDN (By similarity). Found in a complex, at least composed of KIDINS220, MAGI2, NTRK1 and RAPGEF2; the complex is mainly formed at late endosomes in a NGF-dependent manner (By similarity). Interacts with RAPGEF2; the interaction occurs before or after nerve growth factor (NGF) stimulation (By similarity). Interacts (via PDZ domain) with KIDINS220 (via C-terminal domain) (By similarity). Interacts with IGSF9 and HTR4 (PubMed:15466885, PubMed:15340156). Interacts with DLL1 (PubMed:15509766). Found in a complex with IGSF9B and NLGN2; the interaction with IGSF9B is mediated via the PDZ 5 and PDZ 6 domains, while the interaction with NLGN2 is mediated via the WW1, WW2 and PDZ2 domains (PubMed:23751499).By similarity6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Dll1Q614833EBI-297151,EBI-297125

GO - Molecular functioni

  • beta-1 adrenergic receptor binding Source: UniProtKB
  • phosphatase binding Source: UniProtKB
  • receptor signaling complex scaffold activity Source: UniProtKB
  • SMAD binding Source: UniProtKB
  • type II activin receptor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi206123, 4 interactors
CORUMiQ9WVQ1
IntActiQ9WVQ1, 3 interactors
MINTiQ9WVQ1
STRINGi10090.ENSMUSP00000085872

Structurei

3D structure databases

ProteinModelPortaliQ9WVQ1
SMRiQ9WVQ1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini17 – 101PDZ 1PROSITE-ProRule annotationAdd BLAST85
Domaini109 – 283Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST175
Domaini301 – 334WW 1PROSITE-ProRule annotationAdd BLAST34
Domaini347 – 380WW 2PROSITE-ProRule annotationAdd BLAST34
Domaini425 – 509PDZ 2PROSITE-ProRule annotationAdd BLAST85
Domaini604 – 682PDZ 3PROSITE-ProRule annotationAdd BLAST79
Domaini777 – 859PDZ 4PROSITE-ProRule annotationAdd BLAST83
Domaini919 – 1009PDZ 5PROSITE-ProRule annotationAdd BLAST91
Domaini1139 – 1221PDZ 6PROSITE-ProRule annotationAdd BLAST83

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni301 – 380Interaction with DDNBy similarityAdd BLAST80

Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410ISXI Eukaryota
ENOG410XNXK LUCA
GeneTreeiENSGT00650000092997
HOGENOMiHOG000113463
HOVERGENiHBG007091
InParanoidiQ9WVQ1
KOiK05629
PhylomeDBiQ9WVQ1
TreeFamiTF316816

Family and domain databases

CDDicd00201 WW, 2 hits
InterProiView protein in InterPro
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR030036 MAGI2
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR036034 PDZ_sf
IPR001202 WW_dom
IPR036020 WW_dom_sf
PANTHERiPTHR10316:SF27 PTHR10316:SF27, 3 hits
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF00595 PDZ, 5 hits
PF00397 WW, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM00228 PDZ, 6 hits
SM00456 WW, 2 hits
SUPFAMiSSF50156 SSF50156, 6 hits
SSF51045 SSF51045, 2 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS50106 PDZ, 6 hits
PS01159 WW_DOMAIN_1, 2 hits
PS50020 WW_DOMAIN_2, 2 hits

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9WVQ1-1) [UniParc]FASTAAdd to basket
Also known as: long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSKSLKKKSH WTSKVHESVI GRNPEGQLGF ELKGGAENGQ FPYLGEVKPG
60 70 80 90 100
KVAYESGSKL VSEELLLEVN ETPVAGLTIR DVLAVIKHCK DPLRLKCVKQ
110 120 130 140 150
GGIVDKDLRH YLNLRFQKGS VDHELQQIIR DNLYLRTVPC TTRPHKEGEV
160 170 180 190 200
PGVDYIFITV EEFMELEKSG ALLESGTYED NYYGTPKPPA EPAPLLNVTD
210 220 230 240 250
QILPGATPSA EGKRKRNKSV TNMEKASIEP PEEEEEERPV VNGNGVVITP
260 270 280 290 300
ESSEHEDKSA GASGETPSQP YPAPVYSQPE ELKDQMDDTK PTKPEENEDS
310 320 330 340 350
DPLPDNWEMA YTEKGEVYFI DHNTKTTSWL DPRLAKKAKP PEECKENELP
360 370 380 390 400
YGWEKIDDPI YGTYYVDHIN RRTQFENPVL EAKRKLQQHN MPHTELGAKP
410 420 430 440 450
LQAPGFREKP LFTRDASQLK GTFLSTTLKK SNMGFGFTII GGDEPDEFLQ
460 470 480 490 500
VKSVIPDGPA AQDGKMETGD VIVYINEVCV LGHTHADVVK LFQSVPIGQS
510 520 530 540 550
VNLVLCRGYP LPFDPEDPAN SMVPPLAIME RPPPVMVNGR HNYETYLEYI
560 570 580 590 600
SRTSQSVPDI TDRPPHSLHS MPADGQLDGT YPPPVHDDNV SMASSGATQA
610 620 630 640 650
ELMTLTIVKG AQGFGFTIAD SPTGQRVKQI LDIQGCPGLC EGDLIVEINQ
660 670 680 690 700
QNVQNLSHTE VVDILKDCPV GSETSLIIHR GGFFSPWKTP KPMMDRWENQ
710 720 730 740 750
GSPQTSLSAP AVPQNLPFPP ALHRSSFPDS TEAFDPRKPD PYELYEKSRA
760 770 780 790 800
IYESRQQVPP RTSFRMDSSG PDYKELDVHL RRMESGFGFR ILGGDEPGQP
810 820 830 840 850
ILIGAVIAMG SADRDGRLHP GDELVYVDGI PVAGKTHRYV IDLMHHAARN
860 870 880 890 900
GQVNLTVRRK VLCGGEPCPE NGRSPGSVST HHSSPRSDYA TYSNSNHAAP
910 920 930 940 950
SSNASPPEGF ASHSLQTSDV VIHRKENEGF GFVIISSLNR PESGATITVP
960 970 980 990 1000
HKIGRIIDGS PADRCAKLKV GDRILAVNGQ SIINMPHADI VKLIKDAGLS
1010 1020 1030 1040 1050
VTLRIIPQEE LNSPTSAPSS EKQSPMAQQH SPLAQQSPLA QPSPATPNSP
1060 1070 1080 1090 1100
VAQPAPPQPL QLQGHENSYR SEVKARQDVK PDIRQPPFTD YRQPPLDYRQ
1110 1120 1130 1140 1150
PPGGDYSQPP PLDYRQHSPD TRQYPLSDYR QPQDFDYFTV DMEKGAKGFG
1160 1170 1180 1190 1200
FSIRGGREYK MDLYVLRLAE DGPAIRNGRM RVGDQIIEIN GESTRDMTHA
1210 1220 1230 1240 1250
RAIELIKSGG RRVRLLLKRG TGQVPEYGMV PSSLSMCMKS DKHGSPYFYL
1260 1270
LGHPKDTTNP TPGVLPLPPP QACRK
Length:1,275
Mass (Da):140,919
Last modified:October 3, 2003 - v2
Checksum:iF17DC52517806354
GO
Isoform 2 (identifier: Q9WVQ1-2) [UniParc]FASTAAdd to basket
Also known as: short

The sequence of this isoform differs from the canonical sequence as follows:
     1-163: Missing.

Note: Major.
Show »
Length:1,112
Mass (Da):122,599
Checksum:i7B782082930C8490
GO
Isoform 3 (identifier: Q9WVQ1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-390: Missing.
     1229-1275: MVPSSLSMCMKSDKHGSPYFYLLGHPKDTTNPTPGVLPLPPPQACRK → AFHSFLHLCSAFSVF

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:853
Mass (Da):93,543
Checksum:iAE241248B7C055A1
GO
Isoform 4 (identifier: Q9WVQ1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-163: Missing.
     756-770: QQVPPRTSFRMDSSG → R

Note: No experimental confirmation available.
Show »
Length:1,098
Mass (Da):121,080
Checksum:i57B20658576A87B6
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0185801 – 390Missing in isoform 3. 1 PublicationAdd BLAST390
Alternative sequenceiVSP_0084361 – 163Missing in isoform 2 and isoform 4. 3 PublicationsAdd BLAST163
Alternative sequenceiVSP_018581756 – 770QQVPP…MDSSG → R in isoform 4. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_0084371229 – 1275MVPSS…QACRK → AFHSFLHLCSAFSVF in isoform 3. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB029485 mRNA Translation: BAA82294.1
AK039336 mRNA Translation: BAC30321.1
AK147530 mRNA Translation: BAE27976.1
BC059005 mRNA Translation: AAH59005.1
CCDSiCCDS39019.1 [Q9WVQ1-2]
CCDS51424.1 [Q9WVQ1-1]
CCDS51425.1 [Q9WVQ1-4]
RefSeqiNP_001164216.1, NM_001170745.1 [Q9WVQ1-4]
NP_001164217.1, NM_001170746.1 [Q9WVQ1-1]
NP_056638.1, NM_015823.3 [Q9WVQ1-2]
UniGeneiMm.332231
Mm.441283

Genome annotation databases

EnsembliENSMUST00000088516; ENSMUSP00000085872; ENSMUSG00000040003 [Q9WVQ1-1]
ENSMUST00000101558; ENSMUSP00000099094; ENSMUSG00000040003 [Q9WVQ1-4]
ENSMUST00000115267; ENSMUSP00000110922; ENSMUSG00000040003 [Q9WVQ1-2]
ENSMUST00000197553; ENSMUSP00000146769; ENSMUSG00000040003 [Q9WVQ1-3]
GeneIDi50791
KEGGimmu:50791
UCSCiuc008wnv.2 mouse [Q9WVQ1-1]
uc008wnw.2 mouse [Q9WVQ1-4]
uc008wnx.1 mouse [Q9WVQ1-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMAGI2_MOUSE
AccessioniPrimary (citable) accession number: Q9WVQ1
Secondary accession number(s): Q3UH81
, Q6GT88, Q8BYT1, Q8CA85
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2003
Last sequence update: October 3, 2003
Last modified: May 23, 2018
This is version 161 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health