Q9WVC6 (SGK1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 113.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein kinase Sgk1 EC=2.7.11.1 Alternative name(s): Serum/glucocorticoid-regulated kinase 1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 431 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cellular enzymes, transcription factors, neuronal excitability, cell growth, proliferation, survival, migration and apoptosis. Plays an important role in cellular stress response. Contributes to regulation of renal Na+ retention, renal K+ elimination, salt appetite, gastric acid secretion, intestinal Na+/H+ exchange and nutrient transport, insulin-dependent salt sensitivity of blood pressure, salt sensitivity of peripheral glucose uptake, cardiac repolarization and memory consolidation. Up-regulates Na+ channels: SCNN1A/ENAC, SCN5A and ASIC1/ACCN2, K+ channels: KCNJ1/ROMK1, KCNA1-5, KCNQ1-5 and KCNE1, epithelial Ca2+ channels: TRPV5 and TRPV6, chloride channels: BSND, CLCN2 and CFTR, glutamate transporters: SLC1A3/EAAT1, SLC1A2 /EAAT2, SLC1A1/EAAT3, SLC1A6/EAAT4 and SLC1A7/EAAT5, amino acid transporters: SLC1A5/ASCT2, SLC38A1/SN1 and SLC6A19, creatine transporter: SLC6A8, Na+/dicarboxylate cotransporter: SLC13A2/NADC1, Na+-dependent phosphate cotransporter: SLC34A2/NAPI-2B, glutamate receptor: GRIK2/GLUR6. Up-regulates carriers: SLC9A3/NHE3, SLC12A1/NKCC2, SLC12A3/NCC, SLC5A3/SMIT, SLC2A1/GLUT1, SLC5A1/SGLT1 and SLC15A2/PEPT2. Regulates enzymes: GSK3A/B, PMM2 and Na+/K+ ATPase, and transcription factors: CTNNB1 and nuclear factor NF-kappa-B. Stimulates sodium transport into epithelial cells by enhancing the stability and expression of SCNN1A/ENAC. This is achieved by phosphorylating the NEDD4L ubiquitin E3 ligase, promoting its interaction with 14-3-3 proteins, thereby preventing it from binding to SCNN1A/ENAC and targeting it for degradation. Regulates store-operated Ca(+2) entry (SOCE) by stimulating ORAI1 and STIM1. Regulates KCNJ1/ROMK1 directly via its phosphorylation or indirectly via increased interaction with SLC9A3R2/NHERF2. Phosphorylates MDM2 and activates MDM2-dependent ubiquitination of p53/TP53. Phosphorylates MAPT/TAU and mediates microtubule depolymerization and neurite formation in hippocampal neurons. Phosphorylates SLC2A4/GLUT4 and up-regulates its activity. Phosphorylates APBB1/FE65 and promotes its localization to the nucleus. Phosphorylates MAPK1/ERK2 and activates it by enhancing its interaction with MAP2K1/MEK1 and MAP2K2/MEK2. Phosphorylates FBXW7 and plays an inhibitory role in the NOTCH1 signaling. Phosphorylates FOXO1 resulting in its relocalization from the nucleus to the cytoplasm. Phosphorylates FOXO3, promoting its exit from the nucleus and interference with FOXO3-dependent transcription. Phosphorylates BRAF and MAP3K3/MEKK3 and inhibits their activity. Phosphorylates SLC9A3/NHE3 in response to dexamethasone, resulting in its activation and increased localization at the cell membrane. Phosphorylates CREB1. Necessary for vascular remodeling during angiogenesis. Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.13 Ref.14 Ref.15 Ref.16 Ref.17 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Enzyme regulation | Two specific sites, one in the kinase domain (Thr-256) and the other in the C-terminal regulatory region (Ser-422), need to be phosphorylated for its full activation. Phosphorylation at Ser-397 and Ser-401 are also essential for its activity. Activated by WNK1, WNK2, WNK3 and WNK4. Ref.12 |
| Subunit structure | Homodimer; disulfide-linked. Interacts with MAPK3/ERK1, MAPK1/ERK2, MAP2K1/MEK1, MAP2K2/MEK2, NEDD4, NEDD4L, MAPT/TAU, MAPK7, CREB1, SLC9A3R2/NHERF2 and KCNJ1/ROMK1 By similarity. Forms a trimeric complex with FBXW7 and NOTCH1 Associates with the mammalian target of rapamycin complex 2 (mTORC2) via an interaction with MAPKAP1/SIN1. Ref.15 Ref.16 |
| Subcellular location | Cytoplasm By similarity. Nucleus By similarity. Endoplasmic reticulum membrane By similarity. Cell membrane By similarity. Mitochondrion By similarity. Note: The subcellular localization is controlled by the cell cycle, as well as by exposure to specific hormones and environmental stress stimuli. In proliferating cells, it shuttles between the nucleus and cytoplasm in synchrony with the cell cycle, and in serum/growth factor-stimulated cells it resides in the nucleus. In contrast, after exposure to environmental stress or treatment with glucocorticoids, it is detected in the cytoplasm and with certain stress conditions is associated with the mitochondria. In osmoregulation through the epithelial sodium channel, it can be localized to the cytoplasmic surface of the cell membrane. Nuclear, upon phosphorylation By similarity. Ref.17 |
| Induction | Up-regulated by tumor suppressor p53 in mammary epithelial tumor cells. Ref.6 Ref.12 |
| Post-translational modification | Regulated by phosphorylation. Activated by phosphorylation on Ser-422 by mTORC2, transforming it into a substrate for PDPK1 which phosphorylates it on Thr-256. Phosphorylation on Ser-397 and Ser-401 are also essential for its activity. Phosphorylation on Ser-78 by MAPK7 is required for growth factor-induced cell cycle progression By similarity. Ubiquitinated by NEDD4L; which promotes proteasomal degradation. Ubiquitinated by SYVN1 at the endoplasmic reticulum; which promotes rapid proteasomal degradation and maintains a high turnover rate in resting cells By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. Contains 1 AGC-kinase C-terminal domain. Contains 1 protein kinase domain. |
| Sequence caution | The sequence AAH70401.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9WVC6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9WVC6-2) The sequence of this isoform differs from the canonical sequence as follows: 1-25: MTVKAEAARSTLTYSRMRGMVAILI → MVNKDMNGFP...PRTFWTNDDA | ||||||
| Isoform 3 (identifier: Q9WVC6-3) The sequence of this isoform differs from the canonical sequence as follows: 1-25: MTVKAEAARSTLTYSRMRGMVAILI → MGEMQGALARARLESLLRPRHKKRAEAQKRSESVLLSGL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 431 | 431 | Serine/threonine-protein kinase Sgk1 | PRO_0000086643 | |||||
Regions | |||||||||
| Domain | 98 – 355 | 258 | Protein kinase | ||||||
| Domain | 356 – 431 | 76 | AGC-kinase C-terminal | ||||||
| Nucleotide binding | 104 – 112 | 9 | ATP By similarity | ||||||
| Region | 1 – 60 | 60 | Necessary for localization to the mitochondria By similarity | ||||||
| Motif | 131 – 141 | 11 | Nuclear localization signal By similarity | ||||||
| Compositional bias | 131 – 141 | 11 | Glu/Lys-rich | ||||||
Sites | |||||||||
| Active site | 222 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 127 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 74 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 78 | 1 | Phosphoserine; by MAPK7 By similarity | ||||||
| Modified residue | 256 | 1 | Phosphothreonine; by PDPK1 By similarity | ||||||
| Modified residue | 369 | 1 | Phosphothreonine; by PKA By similarity | ||||||
| Modified residue | 397 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 401 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 422 | 1 | Phosphoserine By similarity | ||||||
| Disulfide bond | 193 | Interchain (with C-258) By similarity | |||||||
| Disulfide bond | 258 | Interchain (with C-193) By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 25 | 25 | MTVKA…VAILI → MVNKDMNGFPVKKCSAFQFF KKRVRRWIKSPMVSVDKHQS PNLKYTGPAGVHLPPGESDF EAMCQSCLGDHAFQRGMLPP EESCSWEIQPGCEVKEQCNH ANILTKPDPRTFWTNDDA in isoform 2. | VSP_037788 | |||||
| Alternative sequence | 1 – 25 | 25 | MTVKA…VAILI → MGEMQGALARARLESLLRPR HKKRAEAQKRSESVLLSGL in isoform 3. | VSP_037789 | |||||
Experimental info | |||||||||
| Sequence conflict | 87 | 1 | P → L in BAE26849. Ref.3 | ||||||
| Sequence conflict | 347 | 1 | M → V in BAE26849. Ref.3 | ||||||
| Sequence conflict | 347 | 1 | M → V in BAE26871. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "sgk is an aldosterone-induced kinase in the renal collecting duct. Effects on epithelial Na+ channels." Naray-Fejes-Toth A., Canessa C., Cleaveland E.S., Aldrich G., Fejes-Toth G. J. Biol. Chem. 274:16973-16978(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Regulation of sgk by aldosterone and its effects on the epithelial Na(+) channel." Shigaev A., Asher C., Latter H., Garty H., Reuveny E. Am. J. Physiol. 278:F613-F619(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: C57BL/6J. Tissue: Placenta. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Strain: C57BL/6J. Tissue: Brain and Placenta. |
| [4] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6 and FVB/N. Tissue: Brain. |
| [6] | "p53 stimulates promoter activity of the sgk. serum/glucocorticoid-inducible serine/threonine protein kinase gene in rodent mammary epithelial cells." Maiyar A.C., Huang A.J., Phu P.T., Cha H.H., Firestone G.L. J. Biol. Chem. 271:12414-12422(1996) [PubMed] [Europe PMC] [Abstract] Cited for: REGULATION BY P53. Tissue: Mammary epithelium. |
| [7] | "Expression of the serum- and glucocorticoid-inducible protein kinase, Sgk, is a cell survival response to multiple types of environmental stress stimuli in mammary epithelial cells." Leong M.L.L., Maiyar A.C., Kim B., O'Keeffe B.A., Firestone G.L. J. Biol. Chem. 278:5871-5882(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [8] | "Cell surface expression of the ROMK (Kir 1.1) channel is regulated by the aldosterone-induced kinase, SGK-1, and protein kinase A." Yoo D., Kim B.Y., Campo C., Nance L., King A., Maouyo D., Welling P.A. J. Biol. Chem. 278:23066-23075(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF KCNJ1/ROMK1. |
| [9] | "Glucocorticoid adrenal steroids and glucocorticoid-inducible kinase isoforms in the regulation of GluR6 expression." Strutz-Seebohm N., Seebohm G., Shumilina E., Mack A.F., Wagner H.J., Lampert A., Grahammer F., Henke G., Just L., Skutella T., Hollmann M., Lang F. J. Physiol. (Lond.) 565:391-401(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN REGULATION OF GRIK2/GLUR6. |
| [10] | "Sgk1 activates MDM2-dependent p53 degradation and affects cell proliferation, survival, and differentiation." Amato R., D'Antona L., Porciatti G., Agosti V., Menniti M., Rinaldo C., Costa N., Bellacchio E., Mattarocci S., Fuiano G., Soddu S., Paggi M.G., Lang F., Perrotti N. J. Mol. Med. 87:1221-1239(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF MDM2. |
| [11] | "Serum and glucocorticoid-inducible kinase 1 (SGK1) is necessary for vascular remodeling during angiogenesis." Catela C., Kratsios P., Hede M., Lang F., Rosenthal N. Dev. Dyn. 239:2149-2160(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [12] | "Serum and glucocorticoid-induced kinase (SGK) 1 and the epithelial sodium channel are regulated by multiple with no lysine (WNK) family members." Heise C.J., Xu B.E., Deaton S.L., Cha S.K., Cheng C.J., Earnest S., Sengupta S., Juang Y.C., Stippec S., Xu Y., Zhao Y., Huang C.L., Cobb M.H. J. Biol. Chem. 285:25161-25167(2010) [PubMed] [Europe PMC] [Abstract] Cited for: ENZYME REGULATION. |
| [13] | "Serum- and glucocorticoid-inducible kinase 1 (SGK1) regulates adipocyte differentiation via forkhead box O1." Di Pietro N., Panel V., Hayes S., Bagattin A., Meruvu S., Pandolfi A., Hugendubler L., Fejes-Toth G., Naray-Fejes-Toth A., Mueller E. Mol. Endocrinol. 24:370-380(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF FOXO1. |
| [14] | "Stimulation of Ca2+-channel Orai1/STIM1 by serum- and glucocorticoid-inducible kinase 1 (SGK1)." Eylenstein A., Gehring E.M., Heise N., Shumilina E., Schmidt S., Szteyn K., Muenzer P., Nurbaeva M.K., Eichenmueller M., Tyan L., Regel I., Foeller M., Kuhl D., Soboloff J., Penner R., Lang F. FASEB J. 25:2012-2021(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [15] | "mSIN1 protein mediates SGK1 protein interaction with mTORC2 protein complex and is required for selective activation of the epithelial sodium channel." Lu M., Wang J., Ives H.E., Pearce D. J. Biol. Chem. 286:30647-30654(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH MAPKAP1/SIN1. |
| [16] | "Serum- and glucocorticoid-inducible kinase 1 (SGK1) controls Notch1 signaling by downregulation of protein stability through Fbw7 ubiquitin ligase." Mo J.S., Ann E.J., Yoon J.H., Jung J., Choi Y.H., Kim H.Y., Ahn J.S., Kim S.M., Kim M.Y., Hong J.A., Seo M.S., Lang F., Choi E.J., Park H.S. J. Cell Sci. 124:100-112(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF FBXW7, INTERACTION WITH NOTCH1 AND FBXW7. |
| [17] | "Serum- and glucocorticoid-induced kinase 3 in recycling endosomes mediates acute activation of Na+/H+ exchanger NHE3 by glucocorticoids." He P., Lee S.J., Lin S., Seidler U., Lang F., Fejes-Toth G., Naray-Fejes-Toth A., Yun C.C. Mol. Biol. Cell 22:3812-3825(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN REGULATION OF SLC9A3/NHE3, SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF139638 mRNA. Translation: AAD43302.1. AF205855 mRNA. Translation: AAF19429.1. AK132234 mRNA. Translation: BAE21048.1. AK146037 mRNA. Translation: BAE26849.1. AK146062 mRNA. Translation: BAE26871.1. AK159131 mRNA. Translation: BAE34843.1. AK167364 mRNA. Translation: BAE39461.1. CH466562 Genomic DNA. Translation: EDL03408.1. BC005720 mRNA. Translation: AAH05720.1. BC070401 mRNA. Translation: AAH70401.1. Different initiation. |
| IPI | IPI00125834. IPI00462411. IPI00652180. |
| RefSeq | NP_001155317.2. NM_001161845.2. NP_001155319.1. NM_001161847.2. NP_001155320.1. NM_001161848.2. NP_001155321.1. NM_001161849.2. NP_001155322.1. NM_001161850.2. NP_035491.1. NM_011361.3. |
| UniGene | Mm.28405. |
3D structure databases | |
| ProteinModelPortal | Q9WVC6. |
| SMR | Q9WVC6. Positions 36-426. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-48845N. |
| STRING | 10090.ENSMUSP00000114074. |
PTM databases | |
| PhosphoSite | Q9WVC6. |
Proteomic databases | |
| PRIDE | Q9WVC6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000020145; ENSMUSP00000020145; ENSMUSG00000019970. ENSMUST00000092673; ENSMUSP00000090343; ENSMUSG00000019970. ENSMUST00000120509; ENSMUSP00000114074; ENSMUSG00000019970. |
| GeneID | 20393. |
| KEGG | mmu:20393. |
| UCSC | uc007eov.2. mouse. uc007eow.2. mouse. uc007eox.2. mouse. |
Organism-specific databases | |
| CTD | 6446. |
| MGI | MGI:1340062. Sgk1. |
Phylogenomic databases | |
| eggNOG | COG0515. |
| GeneTree | ENSGT00700000104132. |
| HOGENOM | HOG000233033. |
| HOVERGEN | HBG108317. |
| InParanoid | Q6NS85. |
| KO | K13302. |
| OMA | QFYAVKV. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.1. 3474. |
Gene expression databases | |
| ArrayExpress | Q9WVC6. |
| Bgee | Q9WVC6. |
| CleanEx | MM_SGK1. |
| Genevestigator | Q9WVC6. |
| GermOnline | ENSMUSG00000019970. Mus musculus. |
Family and domain databases | |
| InterPro | IPR000961. AGC-kinase_C. IPR011009. Kinase-like_dom. IPR017892. Pkinase_C. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. PF00433. Pkinase_C. 1 hit. [Graphical view] |
| SMART | SM00133. S_TK_X. 1 hit. SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS51285. AGC_KINASE_CTER. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 298338. |
| SOURCE | Search... |
Entry information
| Entry name | SGK1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9WVC6 Secondary accession number(s): Q3TJN4 Q6NS85 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
