Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9WVC2 (LYNX1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 102. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Ly-6/neurotoxin-like protein 1
Alternative name(s):
GC26
Secreted Ly-6/uPAR domain-containing protein 2
Secreted Ly-6/uPAR-related protein 2
Short name=SLURP-2
Gene names
Name:Lynx1
Synonyms:Slurp2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length131 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Acts in different tissues through interaction to nicotinic acetylcholine receptors (nAChRs). Isoform 2 modulates functional properties of nicotinic acetylcholine receptors (nAChRs) to prevent excessive excitation, and hence neurodegeneration. Enhances desensitization by increasing both the rate and extent of desensitization of alpha4beta2 nAChRs and slowing recovery from desensitization. Promotes large amplitude ACh-evoked currents through alpha4beta2 nAChRs. Prevents plasticity in the primary visual cortex late in life. In keratinocytes, isoform 3 delays differentiation and prevents apoptosis By similarity. Ref.1 Ref.7 Ref.9

Subunit structure

Interacts with nAChRs, including alpha7 (CHRNA7) and alpha4beta2 (CHRNA4/CHRNB2). Ref.7

Subcellular location

Isoform 1: Secreted Potential.

Isoform 2: Cell membrane; Lipid-anchorGPI-anchor Potential. Cell projectiondendrite. Note: Detected in Purkinje cells soma and proximal dendrites.

Isoform 3: Secreted By similarity.

Tissue specificity

Isoform 2 is expressed in neurons of multiple regions in the CNS, including the cerebral cortex, thalamus, substantia nigra, cerebellum, amygdala and hippocampus. Also expressed in kidney, heart and thymus, but at lower levels than in the brain. Expressed in the primary visual cortex (V1) and the lateral geniculate nucleus (at protein level). Isoform 3 is widely expressed, including in dendritic cells, macrophages, B- and T-lymphocytes. Ref.1 Ref.2 Ref.7 Ref.9

Developmental stage

Expressed at very low levels at birth and undergoes a marked up-regulation between postnatal days 10 and 20. Up-regulated in the visual cortex between postnatal day 28 (P28) and P60, when experience-dependent brain plasticity declines. Ref.1 Ref.9

Disruption phenotype

Mutant animals show no gross abnormalities in size, viability, CNS morphology or longevity, but demonstrate enhanced performance in learning ability and memory and are more responsive to nicotine. Aging mutant mice exhibit a vacuolating neurodegeneration that is exacerbated by nicotine. Ref.8

Sequence similarities

Contains 1 UPAR/Ly6 domain.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9WVC2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9WVC2-2)

Also known as: LYNX1;

The sequence of this isoform differs from the canonical sequence as follows:
     52-131: SVTQGLQCHL...CCQSNLCNRD → YFTPYRMKVR...ALLATFWSLL
Note: Contains a potential GPI-anchor site at Gly-93. The propeptide 94-116 may be cleaved out upon GPI-anchor attachment (Potential).
Isoform 3 (identifier: Q9WVC2-3)

Also known as: SLURP-2;

The sequence of this isoform differs from the canonical sequence as follows:
     2-52: THLLTVFLVALMGLPVAQALECHVCAYNGDNCFKPMRCPAMATYCMTTRTS → RLPFWFLLAVVLSMELA

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2020 Potential
Chain21 – 131111Ly-6/neurotoxin-like protein 1
PRO_0000036158

Regions

Domain59 – 12971UPAR/Ly6

Amino acid modifications

Disulfide bond59 ↔ 81 Potential
Disulfide bond62 ↔ 68 Potential
Disulfide bond74 ↔ 102 Potential
Disulfide bond106 ↔ 122 Potential
Disulfide bond123 ↔ 128 Potential

Natural variations

Alternative sequence2 – 5251THLLT…TTRTS → RLPFWFLLAVVLSMELA in isoform 3.
VSP_044162
Alternative sequence52 – 13180SVTQG…LCNRD → YFTPYRMKVRKSCVPSCFET VYDGYSKHASATSCCQYYLC NGAGFATPVTLALVPALLAT FWSLL in isoform 2.
VSP_044163

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 3, 2012. Version 2.
Checksum: 10E142D57821083A

FASTA13114,042
        10         20         30         40         50         60 
MTHLLTVFLV ALMGLPVAQA LECHVCAYNG DNCFKPMRCP AMATYCMTTR TSVTQGLQCH 

        70         80         90        100        110        120 
LCKGFGGCSR PSSCPWSSTH CVIIATRSPI SFTDLPLVTK MCYSGCPDVS SLGLGPHVSI 

       130 
ACCQSNLCNR D 

« Hide

Isoform 2 (LYNX1) [UniParc].

Checksum: DAF442FC1A34DE85
Show »

FASTA11612,835
Isoform 3 (SLURP-2) [UniParc].

Checksum: 8F6D8EA15E951E8F
Show »

FASTA9710,452

References

« Hide 'large scale' references
[1]"Lynx1, an endogenous toxin-like modulator of nicotinic acetylcholine receptors in the mammalian CNS."
Miwa J.M., Ibanez-Tallon I., Crabtree G.W., Sanchez R., Sali A., Role L.W., Heintz N.
Neuron 23:105-114(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Strain: C57BL/6.
Tissue: Cerebellum.
[2]"Immune system expression of SLURP-1 and SLURP-2, two endogenous nicotinic acetylcholine receptor ligands."
Moriwaki Y., Yoshikawa K., Fukuda H., Fujii Y.X., Misawa H., Kawashima K.
Life Sci. 80:2365-2368(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY (ISOFORM 3).
Strain: C57BL/6J.
[3]"Genetic mapping and characterization of Lynx1: a new member of the Ly6/neurotoxin superfamily."
Miwa J.M., Fletcher C.F., Copeland N.G., Jenkins N.A., Heintz N.
Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2).
Strain: 129.
[4]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: C57BL/6J.
Tissue: Hippocampus, Medulla oblongata, Spinal cord and Spleen.
[5]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Strain: FVB/N.
[7]"Novel modulation of neuronal nicotinic acetylcholine receptors by association with the endogenous prototoxin lynx1."
Ibanez-Tallon I., Miwa J.M., Wang H.L., Adams N.C., Crabtree G.W., Sine S.M., Heintz N.
Neuron 33:893-903(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH CHRNA7 AND CHRNA4, TISSUE SPECIFICITY.
[8]"The prototoxin lynx1 acts on nicotinic acetylcholine receptors to balance neuronal activity and survival in vivo."
Miwa J.M., Stevens T.R., King S.L., Caldarone B.J., Ibanez-Tallon I., Xiao C., Fitzsimonds R.M., Pavlides C., Lester H.A., Picciotto M.R., Heintz N.
Neuron 51:587-600(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: DISRUPTION PHENOTYPE.
[9]"Lynx1, a cholinergic brake, limits plasticity in adult visual cortex."
Morishita H., Miwa J.M., Heintz N., Hensch T.K.
Science 330:1238-1240(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION IN VISUAL CORTEX PLASTICITY, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF141377 mRNA. Translation: AAD38939.1.
AB272582 mRNA. Translation: BAF48397.1.
AF169202 Genomic DNA. Translation: AAF16899.1.
AK013827 mRNA. Translation: BAB29006.1.
AK161907 mRNA. Translation: BAE36629.1.
AK162920 mRNA. Translation: BAE37115.1.
AK165295 mRNA. Translation: BAE38124.1.
AK165314 mRNA. Translation: BAE38132.1.
AC118022 Genomic DNA. No translation available.
BC037541 mRNA. Translation: AAH37541.1.
BC115610 mRNA. Translation: AAI15611.1.
BC115611 mRNA. Translation: AAI15612.1.
CCDSCCDS27530.1. [Q9WVC2-2]
RefSeqNP_001075430.1. NM_001081961.1. [Q9WVC2-3]
NP_035968.1. NM_011838.4. [Q9WVC2-2]
UniGeneMm.257067.
Mm.64338.

3D structure databases

ProteinModelPortalQ9WVC2.
SMRQ9WVC2. Positions 21-47.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid204803. 1 interaction.
STRING10090.ENSMUSP00000051457.

Proteomic databases

PaxDbQ9WVC2.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000023259; ENSMUSP00000023259; ENSMUSG00000022594. [Q9WVC2-2]
ENSMUST00000057932; ENSMUSP00000051457; ENSMUSG00000075605. [Q9WVC2-3]
GeneID23936.
69462.
KEGGmmu:23936.
mmu:69462.
UCSCuc007wfw.1. mouse. [Q9WVC2-1]

Organism-specific databases

CTD66004.
MGIMGI:1345180. Lynx1.

Phylogenomic databases

eggNOGNOG113677.
GeneTreeENSGT00720000108940.
ENSGT00730000111571.
HOGENOMHOG000035114.
HOVERGENHBG052377.
InParanoidQ9WVC2.
OMARDISIFQ.
OrthoDBEOG7FBRKT.
TreeFamTF336080.

Gene expression databases

BgeeQ9WVC2.
CleanExMM_LYNX1.
GenevestigatorQ9WVC2.

Family and domain databases

InterProIPR018363. CD59_antigen_CS.
IPR016054. LY6_UPA_recep-like.
IPR001526. LY6_UPAR.
[Graphical view]
PfamPF00021. UPAR_LY6. 2 hits.
[Graphical view]
SMARTSM00134. LU. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio303733.
PROQ9WVC2.
SOURCESearch...

Entry information

Entry nameLYNX1_MOUSE
AccessionPrimary (citable) accession number: Q9WVC2
Secondary accession number(s): Q08EF7, Q3TRB5
Entry history
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: October 3, 2012
Last modified: July 9, 2014
This is version 102 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot