Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9WVC2

- LYNX1_MOUSE

UniProt

Q9WVC2 - LYNX1_MOUSE

Protein

Ly-6/neurotoxin-like protein 1

Gene

Lynx1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Acts in different tissues through interaction to nicotinic acetylcholine receptors (nAChRs). Isoform 2 modulates functional properties of nicotinic acetylcholine receptors (nAChRs) to prevent excessive excitation, and hence neurodegeneration. Enhances desensitization by increasing both the rate and extent of desensitization of alpha4beta2 nAChRs and slowing recovery from desensitization. Promotes large amplitude ACh-evoked currents through alpha4beta2 nAChRs. Prevents plasticity in the primary visual cortex late in life. In keratinocytes, isoform 3 delays differentiation and prevents apoptosis By similarity.By similarity

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ly-6/neurotoxin-like protein 1
    Alternative name(s):
    GC26
    Secreted Ly-6/uPAR domain-containing protein 2
    Secreted Ly-6/uPAR-related protein 2
    Short name:
    SLURP-2
    Gene namesi
    Name:Lynx1
    Synonyms:Slurp2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 15

    Organism-specific databases

    MGIiMGI:1345180. Lynx1.

    Subcellular locationi

    Isoform 2 : Cell membrane Curated; Lipid-anchorGPI-anchor Curated. Cell projectiondendrite
    Note: Detected in Purkinje cells soma and proximal dendrites.
    Isoform 3 : Secreted By similarity

    GO - Cellular componenti

    1. anchored component of membrane Source: UniProtKB-KW
    2. dendrite Source: UniProtKB-SubCell
    3. extracellular region Source: UniProtKB-SubCell
    4. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Cell projection, Membrane, Secreted

    Pathology & Biotechi

    Disruption phenotypei

    Mutant animals show no gross abnormalities in size, viability, CNS morphology or longevity, but demonstrate enhanced performance in learning ability and memory and are more responsive to nicotine. Aging mutant mice exhibit a vacuolating neurodegeneration that is exacerbated by nicotine.1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2020Sequence AnalysisAdd
    BLAST
    Chaini21 – 131111Ly-6/neurotoxin-like protein 1PRO_0000036158Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi59 ↔ 81Sequence Analysis
    Disulfide bondi62 ↔ 68Sequence Analysis
    Disulfide bondi74 ↔ 102Sequence Analysis
    Disulfide bondi106 ↔ 122Sequence Analysis
    Disulfide bondi123 ↔ 128Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

    Proteomic databases

    PaxDbiQ9WVC2.

    Expressioni

    Tissue specificityi

    Isoform 2 is expressed in neurons of multiple regions in the CNS, including the cerebral cortex, thalamus, substantia nigra, cerebellum, amygdala and hippocampus. Also expressed in kidney, heart and thymus, but at lower levels than in the brain. Expressed in the primary visual cortex (V1) and the lateral geniculate nucleus (at protein level). Isoform 3 is widely expressed, including in dendritic cells, macrophages, B- and T-lymphocytes.3 Publications

    Developmental stagei

    Expressed at very low levels at birth and undergoes a marked up-regulation between postnatal days 10 and 20. Up-regulated in the visual cortex between postnatal day 28 (P28) and P60, when experience-dependent brain plasticity declines.2 Publications

    Gene expression databases

    BgeeiQ9WVC2.
    CleanExiMM_LYNX1.
    GenevestigatoriQ9WVC2.

    Interactioni

    Subunit structurei

    Interacts with nAChRs, including alpha7 (CHRNA7) and alpha4beta2 (CHRNA4/CHRNB2).1 Publication

    Protein-protein interaction databases

    BioGridi204803. 1 interaction.
    STRINGi10090.ENSMUSP00000051457.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9WVC2.
    SMRiQ9WVC2. Positions 21-47.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini59 – 12971UPAR/Ly6Add
    BLAST

    Sequence similaritiesi

    Contains 1 UPAR/Ly6 domain.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG113677.
    GeneTreeiENSGT00720000108940.
    ENSGT00730000111571.
    HOGENOMiHOG000035114.
    HOVERGENiHBG052377.
    InParanoidiQ9WVC2.
    OMAiRDISIFQ.
    OrthoDBiEOG7FBRKT.
    TreeFamiTF336080.

    Family and domain databases

    InterProiIPR018363. CD59_antigen_CS.
    IPR016054. LY6_UPA_recep-like.
    IPR001526. LY6_UPAR.
    [Graphical view]
    PfamiPF00021. UPAR_LY6. 2 hits.
    [Graphical view]
    SMARTiSM00134. LU. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9WVC2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTHLLTVFLV ALMGLPVAQA LECHVCAYNG DNCFKPMRCP AMATYCMTTR    50
    TSVTQGLQCH LCKGFGGCSR PSSCPWSSTH CVIIATRSPI SFTDLPLVTK 100
    MCYSGCPDVS SLGLGPHVSI ACCQSNLCNR D 131
    Length:131
    Mass (Da):14,042
    Last modified:October 3, 2012 - v2
    Checksum:i10E142D57821083A
    GO
    Isoform 2 (identifier: Q9WVC2-2) [UniParc]FASTAAdd to Basket

    Also known as: LYNX1

    The sequence of this isoform differs from the canonical sequence as follows:
         52-131: SVTQGLQCHL...CCQSNLCNRD → YFTPYRMKVR...ALLATFWSLL

    Note: Contains a potential GPI-anchor site at Gly-93. The propeptide 94-116 may be cleaved out upon GPI-anchor attachment (Potential).Curated

    Show »
    Length:116
    Mass (Da):12,835
    Checksum:iDAF442FC1A34DE85
    GO
    Isoform 3 (identifier: Q9WVC2-3) [UniParc]FASTAAdd to Basket

    Also known as: SLURP-2

    The sequence of this isoform differs from the canonical sequence as follows:
         2-52: THLLTVFLVALMGLPVAQALECHVCAYNGDNCFKPMRCPAMATYCMTTRTS → RLPFWFLLAVVLSMELA

    Show »
    Length:97
    Mass (Da):10,452
    Checksum:i8F6D8EA15E951E8F
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei2 – 5251THLLT…TTRTS → RLPFWFLLAVVLSMELA in isoform 3. 2 PublicationsVSP_044162Add
    BLAST
    Alternative sequencei52 – 13180SVTQG…LCNRD → YFTPYRMKVRKSCVPSCFET VYDGYSKHASATSCCQYYLC NGAGFATPVTLALVPALLAT FWSLL in isoform 2. 3 PublicationsVSP_044163Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF141377 mRNA. Translation: AAD38939.1.
    AB272582 mRNA. Translation: BAF48397.1.
    AF169202 Genomic DNA. Translation: AAF16899.1.
    AK013827 mRNA. Translation: BAB29006.1.
    AK161907 mRNA. Translation: BAE36629.1.
    AK162920 mRNA. Translation: BAE37115.1.
    AK165295 mRNA. Translation: BAE38124.1.
    AK165314 mRNA. Translation: BAE38132.1.
    AC118022 Genomic DNA. No translation available.
    BC037541 mRNA. Translation: AAH37541.1.
    BC115610 mRNA. Translation: AAI15611.1.
    BC115611 mRNA. Translation: AAI15612.1.
    CCDSiCCDS27530.1. [Q9WVC2-2]
    RefSeqiNP_001075430.1. NM_001081961.1. [Q9WVC2-3]
    NP_035968.1. NM_011838.4. [Q9WVC2-2]
    UniGeneiMm.257067.
    Mm.64338.

    Genome annotation databases

    EnsembliENSMUST00000023259; ENSMUSP00000023259; ENSMUSG00000022594. [Q9WVC2-2]
    ENSMUST00000057932; ENSMUSP00000051457; ENSMUSG00000075605. [Q9WVC2-3]
    GeneIDi23936.
    69462.
    KEGGimmu:23936.
    mmu:69462.
    UCSCiuc007wfw.1. mouse. [Q9WVC2-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF141377 mRNA. Translation: AAD38939.1 .
    AB272582 mRNA. Translation: BAF48397.1 .
    AF169202 Genomic DNA. Translation: AAF16899.1 .
    AK013827 mRNA. Translation: BAB29006.1 .
    AK161907 mRNA. Translation: BAE36629.1 .
    AK162920 mRNA. Translation: BAE37115.1 .
    AK165295 mRNA. Translation: BAE38124.1 .
    AK165314 mRNA. Translation: BAE38132.1 .
    AC118022 Genomic DNA. No translation available.
    BC037541 mRNA. Translation: AAH37541.1 .
    BC115610 mRNA. Translation: AAI15611.1 .
    BC115611 mRNA. Translation: AAI15612.1 .
    CCDSi CCDS27530.1. [Q9WVC2-2 ]
    RefSeqi NP_001075430.1. NM_001081961.1. [Q9WVC2-3 ]
    NP_035968.1. NM_011838.4. [Q9WVC2-2 ]
    UniGenei Mm.257067.
    Mm.64338.

    3D structure databases

    ProteinModelPortali Q9WVC2.
    SMRi Q9WVC2. Positions 21-47.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 204803. 1 interaction.
    STRINGi 10090.ENSMUSP00000051457.

    Proteomic databases

    PaxDbi Q9WVC2.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000023259 ; ENSMUSP00000023259 ; ENSMUSG00000022594 . [Q9WVC2-2 ]
    ENSMUST00000057932 ; ENSMUSP00000051457 ; ENSMUSG00000075605 . [Q9WVC2-3 ]
    GeneIDi 23936.
    69462.
    KEGGi mmu:23936.
    mmu:69462.
    UCSCi uc007wfw.1. mouse. [Q9WVC2-1 ]

    Organism-specific databases

    CTDi 66004.
    MGIi MGI:1345180. Lynx1.

    Phylogenomic databases

    eggNOGi NOG113677.
    GeneTreei ENSGT00720000108940.
    ENSGT00730000111571.
    HOGENOMi HOG000035114.
    HOVERGENi HBG052377.
    InParanoidi Q9WVC2.
    OMAi RDISIFQ.
    OrthoDBi EOG7FBRKT.
    TreeFami TF336080.

    Miscellaneous databases

    NextBioi 303733.
    PROi Q9WVC2.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9WVC2.
    CleanExi MM_LYNX1.
    Genevestigatori Q9WVC2.

    Family and domain databases

    InterProi IPR018363. CD59_antigen_CS.
    IPR016054. LY6_UPA_recep-like.
    IPR001526. LY6_UPAR.
    [Graphical view ]
    Pfami PF00021. UPAR_LY6. 2 hits.
    [Graphical view ]
    SMARTi SM00134. LU. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Lynx1, an endogenous toxin-like modulator of nicotinic acetylcholine receptors in the mammalian CNS."
      Miwa J.M., Ibanez-Tallon I., Crabtree G.W., Sanchez R., Sali A., Role L.W., Heintz N.
      Neuron 23:105-114(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Strain: C57BL/6.
      Tissue: Cerebellum.
    2. "Immune system expression of SLURP-1 and SLURP-2, two endogenous nicotinic acetylcholine receptor ligands."
      Moriwaki Y., Yoshikawa K., Fukuda H., Fujii Y.X., Misawa H., Kawashima K.
      Life Sci. 80:2365-2368(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY (ISOFORM 3).
      Strain: C57BL/6J.
    3. "Genetic mapping and characterization of Lynx1: a new member of the Ly6/neurotoxin superfamily."
      Miwa J.M., Fletcher C.F., Copeland N.G., Jenkins N.A., Heintz N.
      Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2).
      Strain: 129.
    4. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6J.
      Tissue: Hippocampus, Medulla oblongata, Spinal cord and Spleen.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Strain: FVB/N.
    7. "Novel modulation of neuronal nicotinic acetylcholine receptors by association with the endogenous prototoxin lynx1."
      Ibanez-Tallon I., Miwa J.M., Wang H.L., Adams N.C., Crabtree G.W., Sine S.M., Heintz N.
      Neuron 33:893-903(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH CHRNA7 AND CHRNA4, TISSUE SPECIFICITY.
    8. "The prototoxin lynx1 acts on nicotinic acetylcholine receptors to balance neuronal activity and survival in vivo."
      Miwa J.M., Stevens T.R., King S.L., Caldarone B.J., Ibanez-Tallon I., Xiao C., Fitzsimonds R.M., Pavlides C., Lester H.A., Picciotto M.R., Heintz N.
      Neuron 51:587-600(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISRUPTION PHENOTYPE.
    9. "Lynx1, a cholinergic brake, limits plasticity in adult visual cortex."
      Morishita H., Miwa J.M., Heintz N., Hensch T.K.
      Science 330:1238-1240(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN VISUAL CORTEX PLASTICITY, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

    Entry informationi

    Entry nameiLYNX1_MOUSE
    AccessioniPrimary (citable) accession number: Q9WVC2
    Secondary accession number(s): Q08EF7, Q3TRB5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 19, 2002
    Last sequence update: October 3, 2012
    Last modified: October 1, 2014
    This is version 103 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3