SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9WVC2

- LYNX1_MOUSE

UniProt

Q9WVC2 - LYNX1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Ly-6/neurotoxin-like protein 1
Gene
Lynx1, Slurp2
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Acts in different tissues through interaction to nicotinic acetylcholine receptors (nAChRs). Isoform 2 modulates functional properties of nicotinic acetylcholine receptors (nAChRs) to prevent excessive excitation, and hence neurodegeneration. Enhances desensitization by increasing both the rate and extent of desensitization of alpha4beta2 nAChRs and slowing recovery from desensitization. Promotes large amplitude ACh-evoked currents through alpha4beta2 nAChRs. Prevents plasticity in the primary visual cortex late in life. In keratinocytes, isoform 3 delays differentiation and prevents apoptosis By similarity.3 Publications

Names & Taxonomyi

Protein namesi
Recommended name:
Ly-6/neurotoxin-like protein 1
Alternative name(s):
GC26
Secreted Ly-6/uPAR domain-containing protein 2
Secreted Ly-6/uPAR-related protein 2
Short name:
SLURP-2
Gene namesi
Name:Lynx1
Synonyms:Slurp2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 15

Organism-specific databases

MGIiMGI:1345180. Lynx1.

Subcellular locationi

Isoform 1 : Secreted Reviewed prediction
Isoform 2 : Cell membrane; Lipid-anchorGPI-anchor Reviewed prediction. Cell projectiondendrite
Note: Detected in Purkinje cells soma and proximal dendrites.
Isoform 3 : Secreted By similarity

GO - Cellular componenti

  1. anchored component of membrane Source: UniProtKB-KW
  2. dendrite Source: UniProtKB-SubCell
  3. extracellular region Source: UniProtKB-SubCell
  4. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane, Secreted

Pathology & Biotechi

Disruption phenotypei

Mutant animals show no gross abnormalities in size, viability, CNS morphology or longevity, but demonstrate enhanced performance in learning ability and memory and are more responsive to nicotine. Aging mutant mice exhibit a vacuolating neurodegeneration that is exacerbated by nicotine.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020 Reviewed prediction
Add
BLAST
Chaini21 – 131111Ly-6/neurotoxin-like protein 1
PRO_0000036158Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi59 ↔ 81 Reviewed prediction
Disulfide bondi62 ↔ 68 Reviewed prediction
Disulfide bondi74 ↔ 102 Reviewed prediction
Disulfide bondi106 ↔ 122 Reviewed prediction
Disulfide bondi123 ↔ 128 Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

PaxDbiQ9WVC2.

Expressioni

Tissue specificityi

Isoform 2 is expressed in neurons of multiple regions in the CNS, including the cerebral cortex, thalamus, substantia nigra, cerebellum, amygdala and hippocampus. Also expressed in kidney, heart and thymus, but at lower levels than in the brain. Expressed in the primary visual cortex (V1) and the lateral geniculate nucleus (at protein level). Isoform 3 is widely expressed, including in dendritic cells, macrophages, B- and T-lymphocytes.4 Publications

Developmental stagei

Expressed at very low levels at birth and undergoes a marked up-regulation between postnatal days 10 and 20. Up-regulated in the visual cortex between postnatal day 28 (P28) and P60, when experience-dependent brain plasticity declines.2 Publications

Gene expression databases

BgeeiQ9WVC2.
CleanExiMM_LYNX1.
GenevestigatoriQ9WVC2.

Interactioni

Subunit structurei

Interacts with nAChRs, including alpha7 (CHRNA7) and alpha4beta2 (CHRNA4/CHRNB2).1 Publication

Protein-protein interaction databases

BioGridi204803. 1 interaction.
STRINGi10090.ENSMUSP00000051457.

Structurei

3D structure databases

ProteinModelPortaliQ9WVC2.
SMRiQ9WVC2. Positions 21-47.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini59 – 12971UPAR/Ly6
Add
BLAST

Sequence similaritiesi

Contains 1 UPAR/Ly6 domain.

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG113677.
GeneTreeiENSGT00720000108940.
ENSGT00730000111571.
HOGENOMiHOG000035114.
HOVERGENiHBG052377.
InParanoidiQ9WVC2.
OMAiRDISIFQ.
OrthoDBiEOG7FBRKT.
TreeFamiTF336080.

Family and domain databases

InterProiIPR018363. CD59_antigen_CS.
IPR016054. LY6_UPA_recep-like.
IPR001526. LY6_UPAR.
[Graphical view]
PfamiPF00021. UPAR_LY6. 2 hits.
[Graphical view]
SMARTiSM00134. LU. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9WVC2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTHLLTVFLV ALMGLPVAQA LECHVCAYNG DNCFKPMRCP AMATYCMTTR    50
TSVTQGLQCH LCKGFGGCSR PSSCPWSSTH CVIIATRSPI SFTDLPLVTK 100
MCYSGCPDVS SLGLGPHVSI ACCQSNLCNR D 131
Length:131
Mass (Da):14,042
Last modified:October 3, 2012 - v2
Checksum:i10E142D57821083A
GO
Isoform 2 (identifier: Q9WVC2-2) [UniParc]FASTAAdd to Basket

Also known as: LYNX1

The sequence of this isoform differs from the canonical sequence as follows:
     52-131: SVTQGLQCHL...CCQSNLCNRD → YFTPYRMKVR...ALLATFWSLL

Note: Contains a potential GPI-anchor site at Gly-93. The propeptide 94-116 may be cleaved out upon GPI-anchor attachment (Potential).

Show »
Length:116
Mass (Da):12,835
Checksum:iDAF442FC1A34DE85
GO
Isoform 3 (identifier: Q9WVC2-3) [UniParc]FASTAAdd to Basket

Also known as: SLURP-2

The sequence of this isoform differs from the canonical sequence as follows:
     2-52: THLLTVFLVALMGLPVAQALECHVCAYNGDNCFKPMRCPAMATYCMTTRTS → RLPFWFLLAVVLSMELA

Show »
Length:97
Mass (Da):10,452
Checksum:i8F6D8EA15E951E8F
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2 – 5251THLLT…TTRTS → RLPFWFLLAVVLSMELA in isoform 3.
VSP_044162Add
BLAST
Alternative sequencei52 – 13180SVTQG…LCNRD → YFTPYRMKVRKSCVPSCFET VYDGYSKHASATSCCQYYLC NGAGFATPVTLALVPALLAT FWSLL in isoform 2.
VSP_044163Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF141377 mRNA. Translation: AAD38939.1.
AB272582 mRNA. Translation: BAF48397.1.
AF169202 Genomic DNA. Translation: AAF16899.1.
AK013827 mRNA. Translation: BAB29006.1.
AK161907 mRNA. Translation: BAE36629.1.
AK162920 mRNA. Translation: BAE37115.1.
AK165295 mRNA. Translation: BAE38124.1.
AK165314 mRNA. Translation: BAE38132.1.
AC118022 Genomic DNA. No translation available.
BC037541 mRNA. Translation: AAH37541.1.
BC115610 mRNA. Translation: AAI15611.1.
BC115611 mRNA. Translation: AAI15612.1.
CCDSiCCDS27530.1. [Q9WVC2-2]
RefSeqiNP_001075430.1. NM_001081961.1. [Q9WVC2-3]
NP_035968.1. NM_011838.4. [Q9WVC2-2]
UniGeneiMm.257067.
Mm.64338.

Genome annotation databases

EnsembliENSMUST00000023259; ENSMUSP00000023259; ENSMUSG00000022594. [Q9WVC2-2]
ENSMUST00000057932; ENSMUSP00000051457; ENSMUSG00000075605. [Q9WVC2-3]
GeneIDi23936.
69462.
KEGGimmu:23936.
mmu:69462.
UCSCiuc007wfw.1. mouse. [Q9WVC2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF141377 mRNA. Translation: AAD38939.1 .
AB272582 mRNA. Translation: BAF48397.1 .
AF169202 Genomic DNA. Translation: AAF16899.1 .
AK013827 mRNA. Translation: BAB29006.1 .
AK161907 mRNA. Translation: BAE36629.1 .
AK162920 mRNA. Translation: BAE37115.1 .
AK165295 mRNA. Translation: BAE38124.1 .
AK165314 mRNA. Translation: BAE38132.1 .
AC118022 Genomic DNA. No translation available.
BC037541 mRNA. Translation: AAH37541.1 .
BC115610 mRNA. Translation: AAI15611.1 .
BC115611 mRNA. Translation: AAI15612.1 .
CCDSi CCDS27530.1. [Q9WVC2-2 ]
RefSeqi NP_001075430.1. NM_001081961.1. [Q9WVC2-3 ]
NP_035968.1. NM_011838.4. [Q9WVC2-2 ]
UniGenei Mm.257067.
Mm.64338.

3D structure databases

ProteinModelPortali Q9WVC2.
SMRi Q9WVC2. Positions 21-47.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 204803. 1 interaction.
STRINGi 10090.ENSMUSP00000051457.

Proteomic databases

PaxDbi Q9WVC2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000023259 ; ENSMUSP00000023259 ; ENSMUSG00000022594 . [Q9WVC2-2 ]
ENSMUST00000057932 ; ENSMUSP00000051457 ; ENSMUSG00000075605 . [Q9WVC2-3 ]
GeneIDi 23936.
69462.
KEGGi mmu:23936.
mmu:69462.
UCSCi uc007wfw.1. mouse. [Q9WVC2-1 ]

Organism-specific databases

CTDi 66004.
MGIi MGI:1345180. Lynx1.

Phylogenomic databases

eggNOGi NOG113677.
GeneTreei ENSGT00720000108940.
ENSGT00730000111571.
HOGENOMi HOG000035114.
HOVERGENi HBG052377.
InParanoidi Q9WVC2.
OMAi RDISIFQ.
OrthoDBi EOG7FBRKT.
TreeFami TF336080.

Miscellaneous databases

NextBioi 303733.
PROi Q9WVC2.
SOURCEi Search...

Gene expression databases

Bgeei Q9WVC2.
CleanExi MM_LYNX1.
Genevestigatori Q9WVC2.

Family and domain databases

InterProi IPR018363. CD59_antigen_CS.
IPR016054. LY6_UPA_recep-like.
IPR001526. LY6_UPAR.
[Graphical view ]
Pfami PF00021. UPAR_LY6. 2 hits.
[Graphical view ]
SMARTi SM00134. LU. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Lynx1, an endogenous toxin-like modulator of nicotinic acetylcholine receptors in the mammalian CNS."
    Miwa J.M., Ibanez-Tallon I., Crabtree G.W., Sanchez R., Sali A., Role L.W., Heintz N.
    Neuron 23:105-114(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: C57BL/6.
    Tissue: Cerebellum.
  2. "Immune system expression of SLURP-1 and SLURP-2, two endogenous nicotinic acetylcholine receptor ligands."
    Moriwaki Y., Yoshikawa K., Fukuda H., Fujii Y.X., Misawa H., Kawashima K.
    Life Sci. 80:2365-2368(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY (ISOFORM 3).
    Strain: C57BL/6J.
  3. "Genetic mapping and characterization of Lynx1: a new member of the Ly6/neurotoxin superfamily."
    Miwa J.M., Fletcher C.F., Copeland N.G., Jenkins N.A., Heintz N.
    Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2).
    Strain: 129.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Hippocampus, Medulla oblongata, Spinal cord and Spleen.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: FVB/N.
  7. "Novel modulation of neuronal nicotinic acetylcholine receptors by association with the endogenous prototoxin lynx1."
    Ibanez-Tallon I., Miwa J.M., Wang H.L., Adams N.C., Crabtree G.W., Sine S.M., Heintz N.
    Neuron 33:893-903(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CHRNA7 AND CHRNA4, TISSUE SPECIFICITY.
  8. "The prototoxin lynx1 acts on nicotinic acetylcholine receptors to balance neuronal activity and survival in vivo."
    Miwa J.M., Stevens T.R., King S.L., Caldarone B.J., Ibanez-Tallon I., Xiao C., Fitzsimonds R.M., Pavlides C., Lester H.A., Picciotto M.R., Heintz N.
    Neuron 51:587-600(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISRUPTION PHENOTYPE.
  9. "Lynx1, a cholinergic brake, limits plasticity in adult visual cortex."
    Morishita H., Miwa J.M., Heintz N., Hensch T.K.
    Science 330:1238-1240(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN VISUAL CORTEX PLASTICITY, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

Entry informationi

Entry nameiLYNX1_MOUSE
AccessioniPrimary (citable) accession number: Q9WVC2
Secondary accession number(s): Q08EF7, Q3TRB5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: October 3, 2012
Last modified: July 9, 2014
This is version 102 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi