Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ly-6/neurotoxin-like protein 1

Gene

Lynx1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Acts in different tissues through interaction to nicotinic acetylcholine receptors (nAChRs). Isoform 2 modulates functional properties of nicotinic acetylcholine receptors (nAChRs) to prevent excessive excitation, and hence neurodegeneration. Enhances desensitization by increasing both the rate and extent of desensitization of alpha4beta2 nAChRs and slowing recovery from desensitization. Promotes large amplitude ACh-evoked currents through alpha4beta2 nAChRs. Prevents plasticity in the primary visual cortex late in life. In keratinocytes, isoform 3 delays differentiation and prevents apoptosis (By similarity).By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
Ly-6/neurotoxin-like protein 1
Alternative name(s):
GC26
Secreted Ly-6/uPAR domain-containing protein 2
Secreted Ly-6/uPAR-related protein 2
Short name:
SLURP-2
Gene namesi
Name:Lynx1
Synonyms:Slurp2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:1345180. Lynx1.

Subcellular locationi

Isoform 2 :
Isoform 3 :

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane, Secreted

Pathology & Biotechi

Disruption phenotypei

Mutant animals show no gross abnormalities in size, viability, CNS morphology or longevity, but demonstrate enhanced performance in learning ability and memory and are more responsive to nicotine. Aging mutant mice exhibit a vacuolating neurodegeneration that is exacerbated by nicotine.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020Sequence AnalysisAdd
BLAST
Chaini21 – 131111Ly-6/neurotoxin-like protein 1PRO_0000036158Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi59 ↔ 81Sequence Analysis
Disulfide bondi62 ↔ 68Sequence Analysis
Disulfide bondi74 ↔ 102Sequence Analysis
Disulfide bondi106 ↔ 122Sequence Analysis
Disulfide bondi123 ↔ 128Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

PaxDbiQ9WVC2.

Expressioni

Tissue specificityi

Isoform 2 is expressed in neurons of multiple regions in the CNS, including the cerebral cortex, thalamus, substantia nigra, cerebellum, amygdala and hippocampus. Also expressed in kidney, heart and thymus, but at lower levels than in the brain. Expressed in the primary visual cortex (V1) and the lateral geniculate nucleus (at protein level). Isoform 3 is widely expressed, including in dendritic cells, macrophages, B- and T-lymphocytes.3 Publications

Developmental stagei

Expressed at very low levels at birth and undergoes a marked up-regulation between postnatal days 10 and 20. Up-regulated in the visual cortex between postnatal day 28 (P28) and P60, when experience-dependent brain plasticity declines.2 Publications

Gene expression databases

BgeeiQ9WVC2.
CleanExiMM_LYNX1.
GenevisibleiQ9WVC2. MM.

Interactioni

Subunit structurei

Interacts with nAChRs, including alpha7 (CHRNA7) and alpha4beta2 (CHRNA4/CHRNB2).1 Publication

Protein-protein interaction databases

BioGridi204803. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ9WVC2.
SMRiQ9WVC2. Positions 21-47.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini59 – 12971UPAR/Ly6Add
BLAST

Sequence similaritiesi

Contains 1 UPAR/Ly6 domain.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG113677.
GeneTreeiENSGT00720000108940.
ENSGT00730000111571.
HOGENOMiHOG000035114.
HOVERGENiHBG052377.
InParanoidiQ9WVC2.
OMAiSIACCQS.
OrthoDBiEOG7FBRKT.
TreeFamiTF336080.

Family and domain databases

InterProiIPR018363. CD59_antigen_CS.
IPR016054. LY6_UPA_recep-like.
IPR001526. LY6_UPAR.
[Graphical view]
PfamiPF00021. UPAR_LY6. 2 hits.
[Graphical view]
SMARTiSM00134. LU. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9WVC2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTHLLTVFLV ALMGLPVAQA LECHVCAYNG DNCFKPMRCP AMATYCMTTR
60 70 80 90 100
TSVTQGLQCH LCKGFGGCSR PSSCPWSSTH CVIIATRSPI SFTDLPLVTK
110 120 130
MCYSGCPDVS SLGLGPHVSI ACCQSNLCNR D
Length:131
Mass (Da):14,042
Last modified:October 3, 2012 - v2
Checksum:i10E142D57821083A
GO
Isoform 2 (identifier: Q9WVC2-2) [UniParc]FASTAAdd to basket

Also known as: LYNX1

The sequence of this isoform differs from the canonical sequence as follows:
     52-131: SVTQGLQCHL...CCQSNLCNRD → YFTPYRMKVR...ALLATFWSLL

Note: Contains a potential GPI-anchor site at Gly-93. The propeptide 94-116 may be cleaved out upon GPI-anchor attachment (Potential).Curated
Show »
Length:116
Mass (Da):12,835
Checksum:iDAF442FC1A34DE85
GO
Isoform 3 (identifier: Q9WVC2-3) [UniParc]FASTAAdd to basket

Also known as: SLURP-2

The sequence of this isoform differs from the canonical sequence as follows:
     2-52: THLLTVFLVALMGLPVAQALECHVCAYNGDNCFKPMRCPAMATYCMTTRTS → RLPFWFLLAVVLSMELA

Show »
Length:97
Mass (Da):10,452
Checksum:i8F6D8EA15E951E8F
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2 – 5251THLLT…TTRTS → RLPFWFLLAVVLSMELA in isoform 3. 2 PublicationsVSP_044162Add
BLAST
Alternative sequencei52 – 13180SVTQG…LCNRD → YFTPYRMKVRKSCVPSCFET VYDGYSKHASATSCCQYYLC NGAGFATPVTLALVPALLAT FWSLL in isoform 2. 3 PublicationsVSP_044163Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF141377 mRNA. Translation: AAD38939.1.
AB272582 mRNA. Translation: BAF48397.1.
AF169202 Genomic DNA. Translation: AAF16899.1.
AK013827 mRNA. Translation: BAB29006.1.
AK161907 mRNA. Translation: BAE36629.1.
AK162920 mRNA. Translation: BAE37115.1.
AK165295 mRNA. Translation: BAE38124.1.
AK165314 mRNA. Translation: BAE38132.1.
AC118022 Genomic DNA. No translation available.
BC037541 mRNA. Translation: AAH37541.1.
BC115610 mRNA. Translation: AAI15611.1.
BC115611 mRNA. Translation: AAI15612.1.
CCDSiCCDS27530.1. [Q9WVC2-2]
RefSeqiNP_001075430.1. NM_001081961.1. [Q9WVC2-3]
NP_035968.1. NM_011838.4. [Q9WVC2-2]
UniGeneiMm.257067.
Mm.64338.

Genome annotation databases

EnsembliENSMUST00000023259; ENSMUSP00000023259; ENSMUSG00000022594. [Q9WVC2-2]
ENSMUST00000057932; ENSMUSP00000051457; ENSMUSG00000075605. [Q9WVC2-3]
GeneIDi23936.
69462.
KEGGimmu:23936.
mmu:69462.
UCSCiuc007wfw.1. mouse. [Q9WVC2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF141377 mRNA. Translation: AAD38939.1.
AB272582 mRNA. Translation: BAF48397.1.
AF169202 Genomic DNA. Translation: AAF16899.1.
AK013827 mRNA. Translation: BAB29006.1.
AK161907 mRNA. Translation: BAE36629.1.
AK162920 mRNA. Translation: BAE37115.1.
AK165295 mRNA. Translation: BAE38124.1.
AK165314 mRNA. Translation: BAE38132.1.
AC118022 Genomic DNA. No translation available.
BC037541 mRNA. Translation: AAH37541.1.
BC115610 mRNA. Translation: AAI15611.1.
BC115611 mRNA. Translation: AAI15612.1.
CCDSiCCDS27530.1. [Q9WVC2-2]
RefSeqiNP_001075430.1. NM_001081961.1. [Q9WVC2-3]
NP_035968.1. NM_011838.4. [Q9WVC2-2]
UniGeneiMm.257067.
Mm.64338.

3D structure databases

ProteinModelPortaliQ9WVC2.
SMRiQ9WVC2. Positions 21-47.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204803. 1 interaction.

Proteomic databases

PaxDbiQ9WVC2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000023259; ENSMUSP00000023259; ENSMUSG00000022594. [Q9WVC2-2]
ENSMUST00000057932; ENSMUSP00000051457; ENSMUSG00000075605. [Q9WVC2-3]
GeneIDi23936.
69462.
KEGGimmu:23936.
mmu:69462.
UCSCiuc007wfw.1. mouse. [Q9WVC2-1]

Organism-specific databases

CTDi66004.
MGIiMGI:1345180. Lynx1.

Phylogenomic databases

eggNOGiNOG113677.
GeneTreeiENSGT00720000108940.
ENSGT00730000111571.
HOGENOMiHOG000035114.
HOVERGENiHBG052377.
InParanoidiQ9WVC2.
OMAiSIACCQS.
OrthoDBiEOG7FBRKT.
TreeFamiTF336080.

Miscellaneous databases

ChiTaRSiLynx1. mouse.
NextBioi303733.
PROiQ9WVC2.
SOURCEiSearch...

Gene expression databases

BgeeiQ9WVC2.
CleanExiMM_LYNX1.
GenevisibleiQ9WVC2. MM.

Family and domain databases

InterProiIPR018363. CD59_antigen_CS.
IPR016054. LY6_UPA_recep-like.
IPR001526. LY6_UPAR.
[Graphical view]
PfamiPF00021. UPAR_LY6. 2 hits.
[Graphical view]
SMARTiSM00134. LU. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Lynx1, an endogenous toxin-like modulator of nicotinic acetylcholine receptors in the mammalian CNS."
    Miwa J.M., Ibanez-Tallon I., Crabtree G.W., Sanchez R., Sali A., Role L.W., Heintz N.
    Neuron 23:105-114(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: C57BL/6.
    Tissue: Cerebellum.
  2. "Immune system expression of SLURP-1 and SLURP-2, two endogenous nicotinic acetylcholine receptor ligands."
    Moriwaki Y., Yoshikawa K., Fukuda H., Fujii Y.X., Misawa H., Kawashima K.
    Life Sci. 80:2365-2368(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY (ISOFORM 3).
    Strain: C57BL/6J.
  3. "Genetic mapping and characterization of Lynx1: a new member of the Ly6/neurotoxin superfamily."
    Miwa J.M., Fletcher C.F., Copeland N.G., Jenkins N.A., Heintz N.
    Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2).
    Strain: 129.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Hippocampus, Medulla oblongata, Spinal cord and Spleen.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: FVB/N.
  7. "Novel modulation of neuronal nicotinic acetylcholine receptors by association with the endogenous prototoxin lynx1."
    Ibanez-Tallon I., Miwa J.M., Wang H.L., Adams N.C., Crabtree G.W., Sine S.M., Heintz N.
    Neuron 33:893-903(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CHRNA7 AND CHRNA4, TISSUE SPECIFICITY.
  8. "The prototoxin lynx1 acts on nicotinic acetylcholine receptors to balance neuronal activity and survival in vivo."
    Miwa J.M., Stevens T.R., King S.L., Caldarone B.J., Ibanez-Tallon I., Xiao C., Fitzsimonds R.M., Pavlides C., Lester H.A., Picciotto M.R., Heintz N.
    Neuron 51:587-600(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISRUPTION PHENOTYPE.
  9. "Lynx1, a cholinergic brake, limits plasticity in adult visual cortex."
    Morishita H., Miwa J.M., Heintz N., Hensch T.K.
    Science 330:1238-1240(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN VISUAL CORTEX PLASTICITY, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

Entry informationi

Entry nameiLYNX1_MOUSE
AccessioniPrimary (citable) accession number: Q9WVC2
Secondary accession number(s): Q08EF7, Q3TRB5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: October 3, 2012
Last modified: June 24, 2015
This is version 108 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.