Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RNA-binding protein with multiple splicing

Gene

Rbpms

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a coactivator of transcriptional activity. Required to increase TGFB1/Smad-mediated transactivation. Acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity. Increases phosphorylation of SMAD2 and SMAD3 on their C-terminal SSXS motif, possibly through recruitment of TGFBR1. Promotes the nuclear accumulation of SMAD2, SMAD3 and SMAD4 proteins. Binds to poly(A) RNA.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
RNA-binding protein with multiple splicing
Short name:
RBP-MS
Alternative name(s):
Heart and RRM expressed sequence
Short name:
Hermes
Gene namesi
Name:Rbpms
Synonyms:Hermes
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1334446. Rbpms.

Subcellular locationi

  • Nucleus By similarity
  • Cytoplasm By similarity
  • CytoplasmP-body By similarity

  • Note: Translocates into cytoplasmic stress granules that probably correspond to P-bodies in response to oxidative stress.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000817941 – 197RNA-binding protein with multiple splicingAdd BLAST197

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei12PhosphothreonineCombined sources1
Modified residuei113PhosphothreonineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9WVB0.
PRIDEiQ9WVB0.

PTM databases

iPTMnetiQ9WVB0.
PhosphoSitePlusiQ9WVB0.

Expressioni

Tissue specificityi

mRNA expressed in developing heart, with significantly higher expression in the atria relative to the ventricles.1 Publication

Developmental stagei

mRNA already detected at E9.5.1 Publication

Gene expression databases

BgeeiENSMUSG00000031586.
CleanExiMM_RBPMS.
ExpressionAtlasiQ9WVB0. baseline and differential.
GenevisibleiQ9WVB0. MM.

Interactioni

Subunit structurei

Homodimer; each protein chain binds one RNA molecule via the external surface of the homodimer. Interacts with SMAD2, SMAD3 and SMAD4; the interactions are direct.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei27Interaction with RNABy similarity1
Sitei61Interaction with RNABy similarity1

GO - Molecular functioni

Protein-protein interaction databases

BioGridi202831. 1 interactor.
IntActiQ9WVB0. 1 interactor.
MINTiMINT-1866787.
STRINGi10090.ENSMUSP00000033995.

Structurei

3D structure databases

ProteinModelPortaliQ9WVB0.
SMRiQ9WVB0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini24 – 101RRMPROSITE-ProRule annotationAdd BLAST78

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni98 – 105Interaction with RNABy similarity8

Domaini

The RRM domain is necessary for interaction with SMAD4. Both the RRM domain and the C-terminus are required for TGFB1/Smad-mediated transactivation activity (By similarity).By similarity

Sequence similaritiesi

Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1457. Eukaryota.
ENOG410XSBT. LUCA.
GeneTreeiENSGT00500000044861.
HOGENOMiHOG000017369.
HOVERGENiHBG069897.
InParanoidiQ9WVB0.
OrthoDBiEOG091G0K3T.
TreeFamiTF351070.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR024888. RRM_U1_A/B''.
[Graphical view]
PANTHERiPTHR10501. PTHR10501. 1 hit.
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9WVB0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNGGGKAEKE NTPSEANLQE EEVRTLFVSG LPLDIKPREL YLLFRPFKGY
60 70 80 90 100
EGSLIKLTSK QPVGFVSFDS RSEAEAAKNA LNGIRFDPEI PQTLRLEFAK
110 120 130 140 150
ANTKMAKNKL VGTPNPSTPL PNTVPQFIAR EPYELTVPAL YPSSPEVWAP
160 170 180 190
YPLYPAELAP ALPPPAAFTY PASLHAQMRW IPPSEATSQG WKSRQFC
Length:197
Mass (Da):21,816
Last modified:March 6, 2013 - v2
Checksum:i03457D84F803CC78
GO
Isoform 2 (identifier: Q9WVB0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     178-197: MRWIPPSEATSQGWKSRQFC → CFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC

Show »
Length:220
Mass (Da):24,291
Checksum:iF507707B142231BD
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti96L → I in AAD39515 (PubMed:10096065).Curated1
Sequence conflicti126 – 128QFI → HSV in AAD39515 (PubMed:10096065).Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_045747178 – 197MRWIP…SRQFC → CFSPEAKPNTPVFCPLLQQI RFVSGNVFVTYQPTADQQRE LPC in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF148511 mRNA. Translation: AAD39515.1.
AK012265 mRNA. Translation: BAB28128.1.
AK012586 mRNA. Translation: BAB28336.1.
AK041118 mRNA. Translation: BAC30827.1.
AC123616 Genomic DNA. No translation available.
AC127551 Genomic DNA. No translation available.
AC162523 Genomic DNA. No translation available.
BC030397 mRNA. Translation: AAH30397.1.
CCDSiCCDS40317.1. [Q9WVB0-1]
CCDS40318.1. [Q9WVB0-2]
RefSeqiNP_001036139.1. NM_001042674.2. [Q9WVB0-1]
NP_001036140.1. NM_001042675.2. [Q9WVB0-2]
NP_062707.1. NM_019733.3. [Q9WVB0-1]
UniGeneiMm.323997.

Genome annotation databases

EnsembliENSMUST00000033995; ENSMUSP00000033995; ENSMUSG00000031586. [Q9WVB0-2]
ENSMUST00000053251; ENSMUSP00000055813; ENSMUSG00000031586. [Q9WVB0-1]
ENSMUST00000182987; ENSMUSP00000138483; ENSMUSG00000031586. [Q9WVB0-1]
ENSMUST00000191473; ENSMUSP00000140387; ENSMUSG00000031586. [Q9WVB0-1]
GeneIDi19663.
KEGGimmu:19663.
UCSCiuc009lkk.2. mouse. [Q9WVB0-1]
uc009lkn.3. mouse. [Q9WVB0-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF148511 mRNA. Translation: AAD39515.1.
AK012265 mRNA. Translation: BAB28128.1.
AK012586 mRNA. Translation: BAB28336.1.
AK041118 mRNA. Translation: BAC30827.1.
AC123616 Genomic DNA. No translation available.
AC127551 Genomic DNA. No translation available.
AC162523 Genomic DNA. No translation available.
BC030397 mRNA. Translation: AAH30397.1.
CCDSiCCDS40317.1. [Q9WVB0-1]
CCDS40318.1. [Q9WVB0-2]
RefSeqiNP_001036139.1. NM_001042674.2. [Q9WVB0-1]
NP_001036140.1. NM_001042675.2. [Q9WVB0-2]
NP_062707.1. NM_019733.3. [Q9WVB0-1]
UniGeneiMm.323997.

3D structure databases

ProteinModelPortaliQ9WVB0.
SMRiQ9WVB0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi202831. 1 interactor.
IntActiQ9WVB0. 1 interactor.
MINTiMINT-1866787.
STRINGi10090.ENSMUSP00000033995.

PTM databases

iPTMnetiQ9WVB0.
PhosphoSitePlusiQ9WVB0.

Proteomic databases

PaxDbiQ9WVB0.
PRIDEiQ9WVB0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000033995; ENSMUSP00000033995; ENSMUSG00000031586. [Q9WVB0-2]
ENSMUST00000053251; ENSMUSP00000055813; ENSMUSG00000031586. [Q9WVB0-1]
ENSMUST00000182987; ENSMUSP00000138483; ENSMUSG00000031586. [Q9WVB0-1]
ENSMUST00000191473; ENSMUSP00000140387; ENSMUSG00000031586. [Q9WVB0-1]
GeneIDi19663.
KEGGimmu:19663.
UCSCiuc009lkk.2. mouse. [Q9WVB0-1]
uc009lkn.3. mouse. [Q9WVB0-2]

Organism-specific databases

CTDi11030.
MGIiMGI:1334446. Rbpms.

Phylogenomic databases

eggNOGiKOG1457. Eukaryota.
ENOG410XSBT. LUCA.
GeneTreeiENSGT00500000044861.
HOGENOMiHOG000017369.
HOVERGENiHBG069897.
InParanoidiQ9WVB0.
OrthoDBiEOG091G0K3T.
TreeFamiTF351070.

Miscellaneous databases

ChiTaRSiRbpms. mouse.
PROiQ9WVB0.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000031586.
CleanExiMM_RBPMS.
ExpressionAtlasiQ9WVB0. baseline and differential.
GenevisibleiQ9WVB0. MM.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR024888. RRM_U1_A/B''.
[Graphical view]
PANTHERiPTHR10501. PTHR10501. 1 hit.
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRBPMS_MOUSE
AccessioniPrimary (citable) accession number: Q9WVB0
Secondary accession number(s): Q78HG1, Q9CPU5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: March 6, 2013
Last modified: November 2, 2016
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.