Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9WV92

- E41L3_MOUSE

UniProt

Q9WV92 - E41L3_MOUSE

Protein

Band 4.1-like protein 3

Gene

Epb41l3

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 125 (01 Oct 2014)
      Sequence version 1 (01 Nov 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Tumor suppressor that inhibits cell proliferation and promotes apoptosis. Modulates the activity of protein arginine N-methyltransferases, including PRMT3 and PRMT5 By similarity.By similarity

    GO - Molecular functioni

    1. structural constituent of cytoskeleton Source: BHF-UCL

    GO - Biological processi

    1. apoptotic process Source: UniProtKB-KW
    2. cortical actin cytoskeleton organization Source: InterPro
    3. cortical cytoskeleton organization Source: BHF-UCL
    4. cytoskeletal anchoring at plasma membrane Source: BHF-UCL
    5. myelin maintenance Source: BHF-UCL
    6. neuron projection morphogenesis Source: BHF-UCL
    7. paranodal junction assembly Source: BHF-UCL
    8. protein localization to juxtaparanode region of axon Source: BHF-UCL
    9. protein localization to paranode region of axon Source: BHF-UCL
    10. protein localization to plasma membrane Source: BHF-UCL
    11. regulation of cell shape Source: BHF-UCL

    Keywords - Biological processi

    Apoptosis

    Keywords - Ligandi

    Actin-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Band 4.1-like protein 3
    Alternative name(s):
    4.1B
    Differentially expressed in adenocarcinoma of the lung protein 1
    Short name:
    DAL-1
    Short name:
    DAL1P
    Short name:
    mDAL-1
    Cleaved into the following chain:
    Gene namesi
    Name:Epb41l3
    Synonyms:Dal1, Epb4.1l3, Kiaa0987
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 17

    Organism-specific databases

    MGIiMGI:103008. Epb4.1l3.

    Subcellular locationi

    Cytoplasmcytoskeleton By similarity. Cell membrane 1 Publication; Peripheral membrane protein 1 Publication; Cytoplasmic side 1 Publication. Cytoplasm By similarity. Cell junction 1 Publication
    Note: Detected in the cytoplasm of actively dividing cells.

    GO - Cellular componenti

    1. cell-cell junction Source: HGNC
    2. cytoplasm Source: UniProtKB-SubCell
    3. cytoskeleton Source: UniProtKB-SubCell
    4. extrinsic component of membrane Source: InterPro
    5. juxtaparanode region of axon Source: BHF-UCL
    6. paranode region of axon Source: BHF-UCL
    7. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane

    Pathology & Biotechi

    Keywords - Diseasei

    Tumor suppressor

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 929929Band 4.1-like protein 3PRO_0000219400Add
    BLAST
    Initiator methioninei1 – 11Removed; alternateBy similarity
    Chaini2 – 929928Band 4.1-like protein 3, N-terminally processedPRO_0000423195Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionineBy similarity
    Modified residuei2 – 21N-acetylthreonine; in Band 4.1-like protein 3, N-terminally processedBy similarity
    Modified residuei96 – 961Phosphoserine2 Publications
    Modified residuei486 – 4861PhosphoserineBy similarity
    Modified residuei495 – 4951PhosphothreonineBy similarity
    Modified residuei804 – 8041PhosphoserineBy similarity
    Modified residuei923 – 9231Phosphothreonine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ9WV92.
    PaxDbiQ9WV92.
    PRIDEiQ9WV92.

    PTM databases

    PhosphoSiteiQ9WV92.

    Expressioni

    Tissue specificityi

    Detected in brain (at protein level). Highest expression in brain, lower in testis, adrenal gland, heart and kidney. Also present in muscle and epithelial cells. Isoform 1 is expressed in brain, isoform 2 is expressed in heart and isoform 3 is mostly expressed in kidney but also in heart and brain. Isoform 6 seems to be most abundant in kidney while isoform 4 and isoform 5 are predominantly expressed in heart and brain.1 Publication

    Gene expression databases

    ArrayExpressiQ9WV92.
    BgeeiQ9WV92.
    CleanExiMM_EPB4.1L3.
    GenevestigatoriQ9WV92.

    Interactioni

    Subunit structurei

    Interacts (via FERM domain) with CADM1. Interacts with PRMT3, PRMT5 and PRMT6 By similarity. Isoform 2 (heart-specific) has the complete spectrin--actin-binding (SAB) domain and fully interacts with spectrin and actin.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi199461. 2 interactions.
    IntActiQ9WV92. 7 interactions.
    MINTiMINT-4093843.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9WV92.
    SMRiQ9WV92. Positions 116-398.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini118 – 399282FERMPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni402 – 528127HydrophilicAdd
    BLAST
    Regioni559 – 60244Spectrin--actin-bindingAdd
    BLAST
    Regioni777 – 929153C-terminal (CTD)Add
    BLAST

    Sequence similaritiesi

    Contains 1 FERM domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG242913.
    GeneTreeiENSGT00750000117241.
    HOGENOMiHOG000228840.
    HOVERGENiHBG007777.
    KOiK06107.
    OMAiSTDTAIT.
    OrthoDBiEOG7Z69BP.
    PhylomeDBiQ9WV92.
    TreeFamiTF351626.

    Family and domain databases

    Gene3Di1.20.80.10. 1 hit.
    2.30.29.30. 1 hit.
    InterProiIPR008379. Band_4.1_C.
    IPR019749. Band_41_domain.
    IPR019750. Band_41_fam.
    IPR021187. Band_41_protein.
    IPR000798. Ez/rad/moesin_like.
    IPR014847. FERM-adjacent.
    IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
    IPR019748. FERM_central.
    IPR019747. FERM_CS.
    IPR000299. FERM_domain.
    IPR018979. FERM_N.
    IPR018980. FERM_PH-like_C.
    IPR011993. PH_like_dom.
    IPR007477. SAB_dom.
    IPR029071. Ubiquitin-rel_dom.
    [Graphical view]
    PfamiPF05902. 4_1_CTD. 1 hit.
    PF08736. FA. 1 hit.
    PF09380. FERM_C. 1 hit.
    PF00373. FERM_M. 1 hit.
    PF09379. FERM_N. 1 hit.
    PF04382. SAB. 1 hit.
    [Graphical view]
    PIRSFiPIRSF002304. Membrane_skeletal_4_1. 1 hit.
    PRINTSiPR00935. BAND41.
    PR00661. ERMFAMILY.
    SMARTiSM00295. B41. 1 hit.
    [Graphical view]
    SUPFAMiSSF47031. SSF47031. 1 hit.
    SSF54236. SSF54236. 1 hit.
    PROSITEiPS00660. FERM_1. 1 hit.
    PS00661. FERM_2. 1 hit.
    PS50057. FERM_3. 1 hit.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Note: Experimental confirmation may be lacking for some isoforms.

    Isoform 1 (identifier: Q9WV92-1) [UniParc]FASTAAdd to Basket

    Also known as: 4.1B-brain

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTTESGSDSE SKPDQEAEPQ EAAGPQGQAG AQPGPEPAGG NGSLNGEKQQ    50
    PALEQFPEAA AHSTPVKREI GDKDRDFAAA AAKQLEYQQF EDDKLSQRSS 100
    SSKLSRSPLK IVKRPKSMQC KVTLLDGSEY GCDVDKRSRG QVLFDKVCEH 150
    LNLLEKDYFG LTYRDAENQK NWLDPAKEIK KQIRSGAWHF SFNVKFYPPD 200
    PAQLSEDITR YYLCLQLRDD IVSGRLPCSF VTLALLGSYT VQSELGDYDP 250
    DECGNDYISE FRFAPNHTKE LEDKVIELHK SHRGMTPAEA EMHFLENAKK 300
    LSMYGVDLHH AKDSEGVEIM LGVCASGLLI YRDRLRINRF AWPKVLKISY 350
    KRNNFYIKIR PGEFEQFEST IGFKLPNHRA AKRLWKVCVE HHTFFRLLLP 400
    EAPPKKFLTL GSKFRYSGRT QAQTRRASAL IDRPAPYFER SSSKRYTMSR 450
    SLDGASVSEN HEIYMKDSVS AAEVGTGQYA TTKGISQTNL ITTVTPEKKA 500
    EEERVEEEDR RKKAEEATPV TALRHEGKTD SERTDTAADG ETSATESDQE 550
    EDAEIKAQDL DKTQDELMKH QTNISELKRT FLETSTETAL TNEWEKRLST 600
    SPVRLAARQE DAPMIEPLVP EETKQSSGEK LMDGSEILSL LESARKPTEF 650
    IGGVSSTTQS WVQKLETKTE PVEAEVESTP HPQPLSTEKV LQETILVEER 700
    HVMSVHASGD ASHTARDEVD AAESTPTDRR HTGKGKEGSS VTEAAKEQRG 750
    EEVDQSAPEQ EQPATVSHEE EQASTIRTSE GLEQKSHFES STVRVESTSV 800
    GSISPGGAKL EISTKEVPVV HTETKTITYE SSQVDPGADL EPGVLMSAQT 850
    ITSETTSTTT TTHITKTVKG GISETRIEKR IVITGDADID HDQALAQAIK 900
    EAKEQHPDMS VTKVVVHKET EITPEDGED 929
    Length:929
    Mass (Da):103,338
    Last modified:November 1, 1999 - v1
    Checksum:iF4975FF405DA44AE
    GO
    Isoform 2 (identifier: Q9WV92-2) [UniParc]FASTAAdd to Basket

    Also known as: 4.1B-heart

    The sequence of this isoform differs from the canonical sequence as follows:
         547-558: Missing.
         559-559: D → NSLIKRIKGENVYVKHSNLMLED

    Show »
    Length:939
    Mass (Da):104,561
    Checksum:i389443CDEF2CC2A5
    GO
    Isoform 3 (identifier: Q9WV92-3) [UniParc]FASTAAdd to Basket

    Also known as: 4.1B-kidney

    The sequence of this isoform differs from the canonical sequence as follows:
         547-558: Missing.

    Show »
    Length:917
    Mass (Da):101,993
    Checksum:iD0EF7EA95EDA3C24
    GO
    Isoform 4 (identifier: Q9WV92-4) [UniParc]FASTAAdd to Basket

    Also known as: 4.1b-brain

    The sequence of this isoform differs from the canonical sequence as follows:
         894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

    Show »
    Length:894
    Mass (Da):99,510
    Checksum:i2E5E5915A9568B81
    GO
    Isoform 5 (identifier: Q9WV92-5) [UniParc]FASTAAdd to Basket

    Also known as: 4.1B-heart

    The sequence of this isoform differs from the canonical sequence as follows:
         547-558: Missing.
         559-559: D → NSLIKRIKGENVYVKHSNLMLED
         894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

    Show »
    Length:904
    Mass (Da):100,734
    Checksum:i12419E015BB8DD08
    GO
    Isoform 6 (identifier: Q9WV92-6) [UniParc]FASTAAdd to Basket

    Also known as: 4.1B-kidney

    The sequence of this isoform differs from the canonical sequence as follows:
         547-558: Missing.
         894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

    Show »
    Length:882
    Mass (Da):98,166
    Checksum:i94CC9620418FDF2C
    GO
    Isoform 7 (identifier: Q9WV92-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         455-472: Missing.
         547-558: Missing.
         623-663: Missing.
         894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

    Note: Inferred from the cDNA sequence of Ref.2.

    Show »
    Length:823
    Mass (Da):91,850
    Checksum:i2F78D9ADA3DC0674
    GO
    Isoform 8 (identifier: Q9WV92-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         455-472: Missing.
         528-528: K → KSPPGHGAAD...NDPSDSSEEE
         894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

    Show »
    Length:1,052
    Mass (Da):116,785
    Checksum:i3D9A917D79B9E7F5
    GO

    Sequence cautioni

    The sequence AAD51365.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti6 – 105GSDSE → RIRLR in AAD51365. 1 PublicationCurated
    Sequence conflicti28 – 281Q → R in AAD51365. 1 PublicationCurated
    Sequence conflicti288 – 2881A → V in AAD51365. 1 PublicationCurated
    Sequence conflicti306 – 3061V → G in AAD51365. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei455 – 47218Missing in isoform 7 and isoform 8. 2 PublicationsVSP_000487Add
    BLAST
    Alternative sequencei528 – 5281K → KSPPGHGAADSCPPSPPSAH PDPPPPTELRRRCKEKERAE PSSLESEAQGKAYLGDQDVA FSYRQPAGKGTTLFSFSLQL PESFPSLLDEDGYLSFPNLS ETNLLPQSWQHFLPIRSPSL LPCFLFIFFFLLSASFSVPY ALTLSFPLALCLCYLEPKAA SLSASLDNDPSDSSEEE in isoform 8. 1 PublicationVSP_023063
    Alternative sequencei547 – 55812Missing in isoform 2, isoform 3, isoform 5, isoform 6 and isoform 7. 2 PublicationsVSP_000490Add
    BLAST
    Alternative sequencei559 – 5591D → NSLIKRIKGENVYVKHSNLM LED in isoform 2 and isoform 5. 1 PublicationVSP_000489
    Alternative sequencei623 – 66341Missing in isoform 7. 1 PublicationVSP_000488Add
    BLAST
    Alternative sequencei894 – 92936ALAQA…EDGED → E in isoform 4, isoform 5, isoform 6, isoform 7 and isoform 8. 3 PublicationsVSP_000491Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF152247 mRNA. Translation: AAD38048.1.
    AF177146 mRNA. Translation: AAD51365.1. Different initiation.
    AK173080 mRNA. Translation: BAD32358.1.
    CCDSiCCDS28952.1. [Q9WV92-1]
    RefSeqiNP_038841.1. NM_013813.1. [Q9WV92-1]
    UniGeneiMm.131135.

    Genome annotation databases

    EnsembliENSMUST00000080208; ENSMUSP00000079098; ENSMUSG00000024044. [Q9WV92-1]
    ENSMUST00000112680; ENSMUSP00000108300; ENSMUSG00000024044. [Q9WV92-2]
    GeneIDi13823.
    KEGGimmu:13823.
    UCSCiuc008dkp.1. mouse. [Q9WV92-1]
    uc008dkq.1. mouse. [Q9WV92-7]
    uc008dkr.1. mouse. [Q9WV92-8]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF152247 mRNA. Translation: AAD38048.1 .
    AF177146 mRNA. Translation: AAD51365.1 . Different initiation.
    AK173080 mRNA. Translation: BAD32358.1 .
    CCDSi CCDS28952.1. [Q9WV92-1 ]
    RefSeqi NP_038841.1. NM_013813.1. [Q9WV92-1 ]
    UniGenei Mm.131135.

    3D structure databases

    ProteinModelPortali Q9WV92.
    SMRi Q9WV92. Positions 116-398.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 199461. 2 interactions.
    IntActi Q9WV92. 7 interactions.
    MINTi MINT-4093843.

    PTM databases

    PhosphoSitei Q9WV92.

    Proteomic databases

    MaxQBi Q9WV92.
    PaxDbi Q9WV92.
    PRIDEi Q9WV92.

    Protocols and materials databases

    DNASUi 13823.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000080208 ; ENSMUSP00000079098 ; ENSMUSG00000024044 . [Q9WV92-1 ]
    ENSMUST00000112680 ; ENSMUSP00000108300 ; ENSMUSG00000024044 . [Q9WV92-2 ]
    GeneIDi 13823.
    KEGGi mmu:13823.
    UCSCi uc008dkp.1. mouse. [Q9WV92-1 ]
    uc008dkq.1. mouse. [Q9WV92-7 ]
    uc008dkr.1. mouse. [Q9WV92-8 ]

    Organism-specific databases

    CTDi 13823.
    MGIi MGI:103008. Epb4.1l3.
    Rougei Search...

    Phylogenomic databases

    eggNOGi NOG242913.
    GeneTreei ENSGT00750000117241.
    HOGENOMi HOG000228840.
    HOVERGENi HBG007777.
    KOi K06107.
    OMAi STDTAIT.
    OrthoDBi EOG7Z69BP.
    PhylomeDBi Q9WV92.
    TreeFami TF351626.

    Miscellaneous databases

    NextBioi 284624.
    PROi Q9WV92.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9WV92.
    Bgeei Q9WV92.
    CleanExi MM_EPB4.1L3.
    Genevestigatori Q9WV92.

    Family and domain databases

    Gene3Di 1.20.80.10. 1 hit.
    2.30.29.30. 1 hit.
    InterProi IPR008379. Band_4.1_C.
    IPR019749. Band_41_domain.
    IPR019750. Band_41_fam.
    IPR021187. Band_41_protein.
    IPR000798. Ez/rad/moesin_like.
    IPR014847. FERM-adjacent.
    IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
    IPR019748. FERM_central.
    IPR019747. FERM_CS.
    IPR000299. FERM_domain.
    IPR018979. FERM_N.
    IPR018980. FERM_PH-like_C.
    IPR011993. PH_like_dom.
    IPR007477. SAB_dom.
    IPR029071. Ubiquitin-rel_dom.
    [Graphical view ]
    Pfami PF05902. 4_1_CTD. 1 hit.
    PF08736. FA. 1 hit.
    PF09380. FERM_C. 1 hit.
    PF00373. FERM_M. 1 hit.
    PF09379. FERM_N. 1 hit.
    PF04382. SAB. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF002304. Membrane_skeletal_4_1. 1 hit.
    PRINTSi PR00935. BAND41.
    PR00661. ERMFAMILY.
    SMARTi SM00295. B41. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47031. SSF47031. 1 hit.
    SSF54236. SSF54236. 1 hit.
    PROSITEi PS00660. FERM_1. 1 hit.
    PS00661. FERM_2. 1 hit.
    PS50057. FERM_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular and functional characterization of protein 4.1B, a novel member of the protein 4.1 family with high level, focal expression in brain."
      Parra M., Gascard P., Walensky L.D., Gimm J.A., Blackshaw S., Chan N., Takakuwa Y., Berger T., Lee G., Chasis J.A., Snyder S.H., Mohandas N., Conboy J.G.
      J. Biol. Chem. 275:3247-3255(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6), SUBUNIT, SUBCELLULAR LOCATION, ACTIN-BINDING, TISSUE SPECIFICITY.
      Tissue: Brain.
    2. "Mouse DAL-1 (mDAL-1) cDNA sequence."
      Azam M., Andrabi S., Lin L., Newsham I., Chishti A.H.
      Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 6-929 (ISOFORM 7).
      Strain: BALB/c.
      Tissue: Brain.
    3. "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H.
      DNA Res. 11:205-218(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 202-929 (ISOFORM 8).
      Tissue: Fetal brain.
    4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 719-929 (ISOFORMS 4/5/6/7).
    5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic brain.
    6. "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells."
      Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J.
      Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
      Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
      Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96 AND THR-923, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    8. "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations."
      Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M.
      Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain cortex.
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.
    10. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
      Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
      Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic fibroblast.

    Entry informationi

    Entry nameiE41L3_MOUSE
    AccessioniPrimary (citable) accession number: Q9WV92
    Secondary accession number(s): Q69ZT8, Q9R102
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 23, 2002
    Last sequence update: November 1, 1999
    Last modified: October 1, 2014
    This is version 125 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Miscellaneous

    The complete SAB domain is present only in the heart-specific isoforms (isoform 2 and isoform 5).

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3