Q9WV92 (E41L3_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Band 4.1-like protein 3 Alternative name(s): 4.1B Differentially expressed in adenocarcinoma of the lung protein 1 Short name=DAL-1 Short name=DAL1P Short name=mDAL-1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 929 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Isoform 2 (heart-specific) has the complete spectrin--actin-binding (SAB) domain and fully interacts with spectrin and actin. |
| Subunit structure | Interacts with CADM1 By similarity. |
| Subcellular location | Cytoplasm › cytoskeleton By similarity. |
| Tissue specificity | Highest expression in brain, lower in testis, adrenal gland, heart and kidney. Also present in muscle and epithelial cells. Isoform 1 is expressed in brain, isoform 2 is expressed in heart and isoform 3 is mostly expressed in kidney but also in heart and brain. Isoform 6 seems to be most abundant in kidney while isoform 4 and isoform 5 are predominantly expressed in heart and brain. |
| Miscellaneous | The complete SAB domain is present only in the heart-specific isoforms (isoform 2 and isoform 5). |
| Sequence similarities | Contains 1 FERM domain. |
| Sequence caution | The sequence AAD51365.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q9WV92-1) Also known as: 4.1B-brain; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9WV92-2) Also known as: 4.1B-heart; The sequence of this isoform differs from the canonical sequence as follows: 547-558: Missing. 559-559: D → NSLIKRIKGENVYVKHSNLMLED | ||||||
| Isoform 3 (identifier: Q9WV92-3) Also known as: 4.1B-kidney; The sequence of this isoform differs from the canonical sequence as follows: 547-558: Missing. | ||||||
| Isoform 4 (identifier: Q9WV92-4) Also known as: 4.1b-brain; The sequence of this isoform differs from the canonical sequence as follows: 894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E | ||||||
| Isoform 5 (identifier: Q9WV92-5) Also known as: 4.1B-heart; The sequence of this isoform differs from the canonical sequence as follows: 547-558: Missing. 559-559: D → NSLIKRIKGENVYVKHSNLMLED 894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E | ||||||
| Isoform 6 (identifier: Q9WV92-6) Also known as: 4.1B-kidney; The sequence of this isoform differs from the canonical sequence as follows: 547-558: Missing. 894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E | ||||||
| Isoform 7 (identifier: Q9WV92-7) The sequence of this isoform differs from the canonical sequence as follows: 455-472: Missing. 547-558: Missing. 623-663: Missing. 894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E | ||||||
| Note: Inferred from the cDNA sequence of Ref.2. | ||||||
| Isoform 8 (identifier: Q9WV92-8) The sequence of this isoform differs from the canonical sequence as follows: 455-472: Missing. 528-528: K → KSPPGHGAAD...NDPSDSSEEE 894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 929 | 929 | Band 4.1-like protein 3 | PRO_0000219400 | |||||
Regions | |||||||||
| Domain | 118 – 399 | 282 | FERM | ||||||
| Region | 402 – 528 | 127 | Hydrophilic | ||||||
| Region | 559 – 602 | 44 | Spectrin--actin-binding | ||||||
| Region | 777 – 929 | 153 | C-terminal (CTD) | ||||||
Amino acid modifications | |||||||||
| Modified residue | 96 | 1 | Phosphoserine Ref.6 Ref.7 Ref.8 Ref.11 Ref.12 | ||||||
| Modified residue | 428 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 451 | 1 | Phosphoserine Ref.8 Ref.11 | ||||||
| Modified residue | 470 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 486 | 1 | Phosphoserine Ref.5 Ref.6 Ref.8 Ref.9 Ref.12 | ||||||
| Modified residue | 488 | 1 | Phosphothreonine Ref.8 | ||||||
| Modified residue | 495 | 1 | Phosphothreonine Ref.5 Ref.6 Ref.8 Ref.9 | ||||||
| Modified residue | 542 | 1 | Phosphothreonine Ref.8 | ||||||
| Modified residue | 543 | 1 | Phosphoserine Ref.5 Ref.6 Ref.9 | ||||||
| Modified residue | 547 | 1 | Phosphoserine Ref.5 Ref.6 Ref.8 | ||||||
| Modified residue | 599 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 623 | 1 | Phosphothreonine Ref.6 | ||||||
| Modified residue | 626 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 627 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 797 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 798 | 1 | Phosphothreonine Ref.8 Ref.10 | ||||||
| Modified residue | 804 | 1 | Phosphoserine Ref.5 Ref.8 | ||||||
| Modified residue | 923 | 1 | Phosphothreonine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 455 – 472 | 18 | Missing in isoform 7 and isoform 8. | VSP_000487 | |||||
| Alternative sequence | 528 | 1 | K → KSPPGHGAADSCPPSPPSAH PDPPPPTELRRRCKEKERAE PSSLESEAQGKAYLGDQDVA FSYRQPAGKGTTLFSFSLQL PESFPSLLDEDGYLSFPNLS ETNLLPQSWQHFLPIRSPSL LPCFLFIFFFLLSASFSVPY ALTLSFPLALCLCYLEPKAA SLSASLDNDPSDSSEEE in isoform 8. | VSP_023063 | |||||
| Alternative sequence | 547 – 558 | 12 | Missing in isoform 2, isoform 3, isoform 5, isoform 6 and isoform 7. | VSP_000490 | |||||
| Alternative sequence | 559 | 1 | D → NSLIKRIKGENVYVKHSNLM LED in isoform 2 and isoform 5. | VSP_000489 | |||||
| Alternative sequence | 623 – 663 | 41 | Missing in isoform 7. | VSP_000488 | |||||
| Alternative sequence | 894 – 929 | 36 | ALAQA…EDGED → E in isoform 4, isoform 5, isoform 6, isoform 7 and isoform 8. | VSP_000491 | |||||
Experimental info | |||||||||
| Sequence conflict | 6 – 10 | 5 | GSDSE → RIRLR in AAD51365. Ref.2 | ||||||
| Sequence conflict | 28 | 1 | Q → R in AAD51365. Ref.2 | ||||||
| Sequence conflict | 288 | 1 | A → V in AAD51365. Ref.2 | ||||||
| Sequence conflict | 306 | 1 | V → G in AAD51365. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular and functional characterization of protein 4.1B, a novel member of the protein 4.1 family with high level, focal expression in brain." Parra M., Gascard P., Walensky L.D., Gimm J.A., Blackshaw S., Chan N., Takakuwa Y., Berger T., Lee G., Chasis J.A., Snyder S.H., Mohandas N., Conboy J.G. J. Biol. Chem. 275:3247-3255(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6). Tissue: Brain. |
| [2] | "Mouse DAL-1 (mDAL-1) cDNA sequence." Azam M., Andrabi S., Lin L., Newsham I., Chishti A.H. Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 6-929 (ISOFORM 7). Strain: BALB/c. Tissue: Brain. |
| [3] | "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H. DNA Res. 11:205-218(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 202-929 (ISOFORM 8). Tissue: Fetal brain. |
| [4] | Marra M., Hillier L., Kucaba T., Martin J., Beck C., Wylie T., Underwood K., Steptoe M., Theising B., Allen M., Bowers Y., Person B., Swaller T., Gibbons M., Pape D., Harvey N., Schurk R., Ritter E. Wilson R.Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 719-929 (ISOFORMS 4/5/6/7). |
| [5] | "Phosphoproteomic analysis of the developing mouse brain." Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P. Mol. Cell. Proteomics 3:1093-1101(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-470; SER-486; THR-495; SER-543; SER-547 AND SER-804, MASS SPECTROMETRY. Tissue: Embryonic brain. |
| [6] | "Proteomic analysis of in vivo phosphorylated synaptic proteins." Collins M.O., Yu L., Coba M.P., Husi H., Campuzano I., Blackstock W.P., Choudhary J.S., Grant S.G. J. Biol. Chem. 280:5972-5982(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96; SER-486; THR-495; SER-543; SER-547; THR-623; SER-626 AND SER-627, MASS SPECTROMETRY. Tissue: Forebrain. |
| [7] | "Comprehensive identification of phosphorylation sites in postsynaptic density preparations." Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L. Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96 AND THR-923, MASS SPECTROMETRY. Tissue: Brain. |
| [8] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96; SER-451; SER-486; THR-488; THR-495; THR-542; SER-547; THR-798 AND SER-804, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [9] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-486; THR-495 AND SER-543, MASS SPECTROMETRY. Tissue: Liver. |
| [10] | Lubec G., Kang S. Submitted (APR-2007) to UniProtKB Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-797 AND THR-798, MASS SPECTROMETRY. Tissue: Brain. |
| [11] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96; SER-428; SER-451 AND SER-599, MASS SPECTROMETRY. Tissue: Melanoma. |
| [12] | "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry." Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J. Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96 AND SER-486, MASS SPECTROMETRY. Tissue: Embryonic fibroblast. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF152247 mRNA. Translation: AAD38048.1. AF177146 mRNA. Translation: AAD51365.1. Different initiation. AK173080 mRNA. Translation: BAD32358.1. |
| IPI | IPI00125501. IPI00229294. IPI00229295. IPI00229298. IPI00229299. IPI00229300. IPI00406263. IPI00464296. |
| RefSeq | NP_038841.1. NM_013813.1. |
| UniGene | Mm.131135. |
3D structure databases | |
| ProteinModelPortal | Q9WV92. |
| SMR | Q9WV92. Positions 116-398. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9WV92. 6 interactions. |
PTM databases | |
| PhosphoSite | Q9WV92. |
Proteomic databases | |
| PaxDb | Q9WV92. |
| PRIDE | Q9WV92. |
Protocols and materials databases | |
| DNASU | 13823. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000080208; ENSMUSP00000079098; ENSMUSG00000024044. ENSMUST00000112680; ENSMUSP00000108300; ENSMUSG00000024044. |
| GeneID | 13823. |
| KEGG | mmu:13823. |
| UCSC | uc008dkp.1. mouse. uc008dkq.1. mouse. uc008dkr.1. mouse. |
Organism-specific databases | |
| CTD | 13823. |
| MGI | MGI:103008. Epb4.1l3. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | NOG242913. |
| GeneTree | ENSGT00690000101906. |
| HOGENOM | HOG000228840. |
| HOVERGEN | HBG007777. |
| KO | K06107. |
| OMA | AITNEWE. |
| OrthoDB | EOG4Z8XVQ. |
Gene expression databases | |
| ArrayExpress | Q9WV92. |
| Bgee | Q9WV92. |
| CleanEx | MM_EPB4.1L3. |
| Genevestigator | Q9WV92. |
| GermOnline | ENSMUSG00000024044. Mus musculus. |
Family and domain databases | |
| Gene3D | 1.20.80.10. 1 hit. 2.30.29.30. 1 hit. |
| InterPro | IPR008379. Band_4.1_C. IPR019749. Band_41_domain. IPR019750. Band_41_fam. IPR021187. Band_41_protein. IPR000798. Ez/rad/moesin_like. IPR014847. FERM-adjacent. IPR014352. FERM/acyl-CoA-bd_prot_3-hlx. IPR019748. FERM_central. IPR019747. FERM_CS. IPR000299. FERM_domain. IPR018979. FERM_N. IPR018980. FERM_PH-like_C. IPR011993. PH_like_dom. IPR007477. SAB_dom. [Graphical view] |
| Pfam | PF05902. 4_1_CTD. 1 hit. PF08736. FA. 1 hit. PF09380. FERM_C. 1 hit. PF00373. FERM_M. 1 hit. PF09379. FERM_N. 1 hit. PF04382. SAB. 1 hit. [Graphical view] |
| PIRSF | PIRSF002304. Membrane_skeletal_4_1. 1 hit. |
| PRINTS | PR00935. BAND41. PR00661. ERMFAMILY. |
| SMART | SM00295. B41. 1 hit. [Graphical view] |
| SUPFAM | SSF47031. FERM_3-hlx. 1 hit. |
| PROSITE | PS00660. FERM_1. 1 hit. PS00661. FERM_2. 1 hit. PS50057. FERM_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 284624. |
| SOURCE | Search... |
Entry information
| Entry name | E41L3_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9WV92 Secondary accession number(s): Q69ZT8, Q9R102 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
