Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Band 4.1-like protein 3

Gene

Epb41l3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Tumor suppressor that inhibits cell proliferation and promotes apoptosis. Modulates the activity of protein arginine N-methyltransferases, including PRMT3 and PRMT5 (By similarity).By similarity

GO - Molecular functioni

  • structural constituent of cytoskeleton Source: BHF-UCL

GO - Biological processi

  • actomyosin structure organization Source: GO_Central
  • apoptotic process Source: UniProtKB-KW
  • cortical actin cytoskeleton organization Source: InterPro
  • cortical cytoskeleton organization Source: BHF-UCL
  • cytoskeletal anchoring at plasma membrane Source: BHF-UCL
  • myelin maintenance Source: BHF-UCL
  • neuron projection morphogenesis Source: BHF-UCL
  • paranodal junction assembly Source: BHF-UCL
  • protein localization to juxtaparanode region of axon Source: BHF-UCL
  • protein localization to paranode region of axon Source: BHF-UCL
  • protein localization to plasma membrane Source: BHF-UCL
  • regulation of cell growth Source: InterPro
  • regulation of cell shape Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Apoptosis

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

ReactomeiR-MMU-6794361. Interactions of neurexins and neuroligins at synapses.

Names & Taxonomyi

Protein namesi
Recommended name:
Band 4.1-like protein 3
Alternative name(s):
4.1B
Differentially expressed in adenocarcinoma of the lung protein 1
Short name:
DAL-1
Short name:
DAL1P
Short name:
mDAL-1
Cleaved into the following chain:
Gene namesi
Name:Epb41l3
Synonyms:Dal1, Epb4.1l3, Kiaa0987
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:103008. Epb41l3.

Subcellular locationi

GO - Cellular componenti

  • axolemma Source: Ensembl
  • cell-cell junction Source: HGNC
  • cytoplasm Source: UniProtKB-SubCell
  • cytoskeleton Source: GO_Central
  • extrinsic component of membrane Source: InterPro
  • juxtaparanode region of axon Source: BHF-UCL
  • paranode region of axon Source: BHF-UCL
  • plasma membrane Source: MGI
  • postsynaptic density Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002194001 – 929Band 4.1-like protein 3Add BLAST929
Initiator methionineiRemoved; alternateBy similarity
ChainiPRO_00004231952 – 929Band 4.1-like protein 3, N-terminally processedAdd BLAST928

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei2N-acetylthreonine; in Band 4.1-like protein 3, N-terminally processedBy similarity1
Modified residuei96PhosphoserineCombined sources1
Modified residuei428PhosphoserineBy similarity1
Modified residuei451PhosphoserineCombined sources1
Modified residuei486PhosphoserineCombined sources1
Modified residuei495PhosphothreonineCombined sources1
Modified residuei518PhosphothreonineCombined sources1
Modified residuei543PhosphoserineCombined sources1
Modified residuei545PhosphothreonineCombined sources1
Modified residuei547PhosphoserineCombined sources1
Modified residuei725PhosphothreonineCombined sources1
Modified residuei802PhosphoserineCombined sources1
Modified residuei804PhosphoserineCombined sources1
Modified residuei923PhosphothreonineCombined sources1
Isoform 7 (identifier: Q9WV92-7)
Modified residuei451PhosphoserineCombined sources1
Modified residuei525PhosphoserineCombined sources1
Isoform 8 (identifier: Q9WV92-8)
Modified residuei451PhosphoserineCombined sources1
Isoform 3 (identifier: Q9WV92-3)
Modified residuei543PhosphoserineCombined sources1
Isoform 6 (identifier: Q9WV92-6)
Modified residuei543PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9WV92.
PeptideAtlasiQ9WV92.
PRIDEiQ9WV92.

PTM databases

iPTMnetiQ9WV92.
PhosphoSitePlusiQ9WV92.
SwissPalmiQ9WV92.

Expressioni

Tissue specificityi

Detected in brain (at protein level). Highest expression in brain, lower in testis, adrenal gland, heart and kidney. Also present in muscle and epithelial cells. Isoform 1 is expressed in brain, isoform 2 is expressed in heart and isoform 3 is mostly expressed in kidney but also in heart and brain. Isoform 6 seems to be most abundant in kidney while isoform 4 and isoform 5 are predominantly expressed in heart and brain.1 Publication

Gene expression databases

BgeeiENSMUSG00000024044.
CleanExiMM_EPB4.1L3.
GenevisibleiQ9WV92. MM.

Interactioni

Subunit structurei

Interacts (via FERM domain) with CADM1. Interacts with PRMT3, PRMT5 and PRMT6 (By similarity). Isoform 2 (heart-specific) has the complete spectrin--actin-binding (SAB) domain and fully interacts with spectrin and actin.By similarity1 Publication

Protein-protein interaction databases

BioGridi199461. 3 interactors.
IntActiQ9WV92. 8 interactors.
MINTiMINT-4093843.
STRINGi10090.ENSMUSP00000079098.

Structurei

3D structure databases

ProteinModelPortaliQ9WV92.
SMRiQ9WV92.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini118 – 399FERMPROSITE-ProRule annotationAdd BLAST282

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni402 – 528HydrophilicAdd BLAST127
Regioni559 – 602Spectrin--actin-bindingAdd BLAST44
Regioni777 – 929C-terminal (CTD)Add BLAST153

Sequence similaritiesi

Contains 1 FERM domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3527. Eukaryota.
ENOG410Y7NQ. LUCA.
GeneTreeiENSGT00760000118823.
HOGENOMiHOG000228840.
HOVERGENiHBG007777.
InParanoidiQ9WV92.
KOiK06107.
OMAiAITNEWE.
OrthoDBiEOG091G00IL.
PhylomeDBiQ9WV92.
TreeFamiTF351626.

Family and domain databases

Gene3Di1.20.80.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR030691. Band4.1-L3.
IPR008379. Band_4.1_C.
IPR019749. Band_41_domain.
IPR000798. Ez/rad/moesin-like.
IPR014847. FERM-adjacent.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
IPR019748. FERM_central.
IPR019747. FERM_CS.
IPR000299. FERM_domain.
IPR018979. FERM_N.
IPR018980. FERM_PH-like_C.
IPR011993. PH_dom-like.
IPR007477. SAB_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PANTHERiPTHR23280:SF20. PTHR23280:SF20. 2 hits.
PfamiPF05902. 4_1_CTD. 1 hit.
PF08736. FA. 1 hit.
PF09380. FERM_C. 1 hit.
PF00373. FERM_M. 1 hit.
PF09379. FERM_N. 1 hit.
PF04382. SAB. 1 hit.
[Graphical view]
PRINTSiPR00935. BAND41.
PR00661. ERMFAMILY.
SMARTiSM00295. B41. 1 hit.
SM01195. FA. 1 hit.
SM01196. FERM_C. 1 hit.
[Graphical view]
SUPFAMiSSF47031. SSF47031. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS00660. FERM_1. 1 hit.
PS00661. FERM_2. 1 hit.
PS50057. FERM_3. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q9WV92-1) [UniParc]FASTAAdd to basket
Also known as: 4.1B-brain

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTTESGSDSE SKPDQEAEPQ EAAGPQGQAG AQPGPEPAGG NGSLNGEKQQ
60 70 80 90 100
PALEQFPEAA AHSTPVKREI GDKDRDFAAA AAKQLEYQQF EDDKLSQRSS
110 120 130 140 150
SSKLSRSPLK IVKRPKSMQC KVTLLDGSEY GCDVDKRSRG QVLFDKVCEH
160 170 180 190 200
LNLLEKDYFG LTYRDAENQK NWLDPAKEIK KQIRSGAWHF SFNVKFYPPD
210 220 230 240 250
PAQLSEDITR YYLCLQLRDD IVSGRLPCSF VTLALLGSYT VQSELGDYDP
260 270 280 290 300
DECGNDYISE FRFAPNHTKE LEDKVIELHK SHRGMTPAEA EMHFLENAKK
310 320 330 340 350
LSMYGVDLHH AKDSEGVEIM LGVCASGLLI YRDRLRINRF AWPKVLKISY
360 370 380 390 400
KRNNFYIKIR PGEFEQFEST IGFKLPNHRA AKRLWKVCVE HHTFFRLLLP
410 420 430 440 450
EAPPKKFLTL GSKFRYSGRT QAQTRRASAL IDRPAPYFER SSSKRYTMSR
460 470 480 490 500
SLDGASVSEN HEIYMKDSVS AAEVGTGQYA TTKGISQTNL ITTVTPEKKA
510 520 530 540 550
EEERVEEEDR RKKAEEATPV TALRHEGKTD SERTDTAADG ETSATESDQE
560 570 580 590 600
EDAEIKAQDL DKTQDELMKH QTNISELKRT FLETSTETAL TNEWEKRLST
610 620 630 640 650
SPVRLAARQE DAPMIEPLVP EETKQSSGEK LMDGSEILSL LESARKPTEF
660 670 680 690 700
IGGVSSTTQS WVQKLETKTE PVEAEVESTP HPQPLSTEKV LQETILVEER
710 720 730 740 750
HVMSVHASGD ASHTARDEVD AAESTPTDRR HTGKGKEGSS VTEAAKEQRG
760 770 780 790 800
EEVDQSAPEQ EQPATVSHEE EQASTIRTSE GLEQKSHFES STVRVESTSV
810 820 830 840 850
GSISPGGAKL EISTKEVPVV HTETKTITYE SSQVDPGADL EPGVLMSAQT
860 870 880 890 900
ITSETTSTTT TTHITKTVKG GISETRIEKR IVITGDADID HDQALAQAIK
910 920
EAKEQHPDMS VTKVVVHKET EITPEDGED
Length:929
Mass (Da):103,338
Last modified:November 1, 1999 - v1
Checksum:iF4975FF405DA44AE
GO
Isoform 2 (identifier: Q9WV92-2) [UniParc]FASTAAdd to basket
Also known as: 4.1B-heart

The sequence of this isoform differs from the canonical sequence as follows:
     547-558: Missing.
     559-559: D → NSLIKRIKGENVYVKHSNLMLED

Show »
Length:939
Mass (Da):104,561
Checksum:i389443CDEF2CC2A5
GO
Isoform 3 (identifier: Q9WV92-3) [UniParc]FASTAAdd to basket
Also known as: 4.1B-kidney

The sequence of this isoform differs from the canonical sequence as follows:
     547-558: Missing.

Show »
Length:917
Mass (Da):101,993
Checksum:iD0EF7EA95EDA3C24
GO
Isoform 4 (identifier: Q9WV92-4) [UniParc]FASTAAdd to basket
Also known as: 4.1b-brain

The sequence of this isoform differs from the canonical sequence as follows:
     894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

Show »
Length:894
Mass (Da):99,510
Checksum:i2E5E5915A9568B81
GO
Isoform 5 (identifier: Q9WV92-5) [UniParc]FASTAAdd to basket
Also known as: 4.1B-heart

The sequence of this isoform differs from the canonical sequence as follows:
     547-558: Missing.
     559-559: D → NSLIKRIKGENVYVKHSNLMLED
     894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

Show »
Length:904
Mass (Da):100,734
Checksum:i12419E015BB8DD08
GO
Isoform 6 (identifier: Q9WV92-6) [UniParc]FASTAAdd to basket
Also known as: 4.1B-kidney

The sequence of this isoform differs from the canonical sequence as follows:
     547-558: Missing.
     894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

Show »
Length:882
Mass (Da):98,166
Checksum:i94CC9620418FDF2C
GO
Isoform 7 (identifier: Q9WV92-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     455-472: Missing.
     547-558: Missing.
     623-663: Missing.
     894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

Note: Inferred from the cDNA sequence of Ref. 2.Combined sources
Show »
Length:823
Mass (Da):91,850
Checksum:i2F78D9ADA3DC0674
GO
Isoform 8 (identifier: Q9WV92-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     455-472: Missing.
     528-528: K → KSPPGHGAAD...NDPSDSSEEE
     894-929: ALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED → E

Show »
Length:1,052
Mass (Da):116,785
Checksum:i3D9A917D79B9E7F5
GO

Sequence cautioni

The sequence AAD51365 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti6 – 10GSDSE → RIRLR in AAD51365 (Ref. 2) Curated5
Sequence conflicti28Q → R in AAD51365 (Ref. 2) Curated1
Sequence conflicti288A → V in AAD51365 (Ref. 2) Curated1
Sequence conflicti306V → G in AAD51365 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000487455 – 472Missing in isoform 7 and isoform 8. 2 PublicationsAdd BLAST18
Alternative sequenceiVSP_023063528K → KSPPGHGAADSCPPSPPSAH PDPPPPTELRRRCKEKERAE PSSLESEAQGKAYLGDQDVA FSYRQPAGKGTTLFSFSLQL PESFPSLLDEDGYLSFPNLS ETNLLPQSWQHFLPIRSPSL LPCFLFIFFFLLSASFSVPY ALTLSFPLALCLCYLEPKAA SLSASLDNDPSDSSEEE in isoform 8. 1 Publication1
Alternative sequenceiVSP_000490547 – 558Missing in isoform 2, isoform 3, isoform 5, isoform 6 and isoform 7. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_000489559D → NSLIKRIKGENVYVKHSNLM LED in isoform 2 and isoform 5. 1 Publication1
Alternative sequenceiVSP_000488623 – 663Missing in isoform 7. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_000491894 – 929ALAQA…EDGED → E in isoform 4, isoform 5, isoform 6, isoform 7 and isoform 8. 3 PublicationsAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF152247 mRNA. Translation: AAD38048.1.
AF177146 mRNA. Translation: AAD51365.1. Different initiation.
AK173080 mRNA. Translation: BAD32358.1.
CCDSiCCDS28952.1. [Q9WV92-1]
RefSeqiNP_038841.1. NM_013813.1. [Q9WV92-1]
XP_011244586.1. XM_011246284.1. [Q9WV92-8]
XP_011244591.1. XM_011246289.1. [Q9WV92-7]
XP_017172724.1. XM_017317235.1. [Q9WV92-4]
XP_017172725.1. XM_017317236.1. [Q9WV92-1]
UniGeneiMm.131135.

Genome annotation databases

EnsembliENSMUST00000080208; ENSMUSP00000079098; ENSMUSG00000024044. [Q9WV92-1]
ENSMUST00000112680; ENSMUSP00000108300; ENSMUSG00000024044. [Q9WV92-2]
GeneIDi13823.
KEGGimmu:13823.
UCSCiuc008dkp.1. mouse. [Q9WV92-1]
uc008dkq.1. mouse. [Q9WV92-7]
uc008dkr.1. mouse. [Q9WV92-8]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF152247 mRNA. Translation: AAD38048.1.
AF177146 mRNA. Translation: AAD51365.1. Different initiation.
AK173080 mRNA. Translation: BAD32358.1.
CCDSiCCDS28952.1. [Q9WV92-1]
RefSeqiNP_038841.1. NM_013813.1. [Q9WV92-1]
XP_011244586.1. XM_011246284.1. [Q9WV92-8]
XP_011244591.1. XM_011246289.1. [Q9WV92-7]
XP_017172724.1. XM_017317235.1. [Q9WV92-4]
XP_017172725.1. XM_017317236.1. [Q9WV92-1]
UniGeneiMm.131135.

3D structure databases

ProteinModelPortaliQ9WV92.
SMRiQ9WV92.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi199461. 3 interactors.
IntActiQ9WV92. 8 interactors.
MINTiMINT-4093843.
STRINGi10090.ENSMUSP00000079098.

PTM databases

iPTMnetiQ9WV92.
PhosphoSitePlusiQ9WV92.
SwissPalmiQ9WV92.

Proteomic databases

PaxDbiQ9WV92.
PeptideAtlasiQ9WV92.
PRIDEiQ9WV92.

Protocols and materials databases

DNASUi13823.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000080208; ENSMUSP00000079098; ENSMUSG00000024044. [Q9WV92-1]
ENSMUST00000112680; ENSMUSP00000108300; ENSMUSG00000024044. [Q9WV92-2]
GeneIDi13823.
KEGGimmu:13823.
UCSCiuc008dkp.1. mouse. [Q9WV92-1]
uc008dkq.1. mouse. [Q9WV92-7]
uc008dkr.1. mouse. [Q9WV92-8]

Organism-specific databases

CTDi23136.
MGIiMGI:103008. Epb41l3.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG3527. Eukaryota.
ENOG410Y7NQ. LUCA.
GeneTreeiENSGT00760000118823.
HOGENOMiHOG000228840.
HOVERGENiHBG007777.
InParanoidiQ9WV92.
KOiK06107.
OMAiAITNEWE.
OrthoDBiEOG091G00IL.
PhylomeDBiQ9WV92.
TreeFamiTF351626.

Enzyme and pathway databases

ReactomeiR-MMU-6794361. Interactions of neurexins and neuroligins at synapses.

Miscellaneous databases

PROiQ9WV92.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000024044.
CleanExiMM_EPB4.1L3.
GenevisibleiQ9WV92. MM.

Family and domain databases

Gene3Di1.20.80.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR030691. Band4.1-L3.
IPR008379. Band_4.1_C.
IPR019749. Band_41_domain.
IPR000798. Ez/rad/moesin-like.
IPR014847. FERM-adjacent.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
IPR019748. FERM_central.
IPR019747. FERM_CS.
IPR000299. FERM_domain.
IPR018979. FERM_N.
IPR018980. FERM_PH-like_C.
IPR011993. PH_dom-like.
IPR007477. SAB_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PANTHERiPTHR23280:SF20. PTHR23280:SF20. 2 hits.
PfamiPF05902. 4_1_CTD. 1 hit.
PF08736. FA. 1 hit.
PF09380. FERM_C. 1 hit.
PF00373. FERM_M. 1 hit.
PF09379. FERM_N. 1 hit.
PF04382. SAB. 1 hit.
[Graphical view]
PRINTSiPR00935. BAND41.
PR00661. ERMFAMILY.
SMARTiSM00295. B41. 1 hit.
SM01195. FA. 1 hit.
SM01196. FERM_C. 1 hit.
[Graphical view]
SUPFAMiSSF47031. SSF47031. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS00660. FERM_1. 1 hit.
PS00661. FERM_2. 1 hit.
PS50057. FERM_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiE41L3_MOUSE
AccessioniPrimary (citable) accession number: Q9WV92
Secondary accession number(s): Q69ZT8, Q9R102
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: November 1, 1999
Last modified: November 30, 2016
This is version 145 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

The complete SAB domain is present only in the heart-specific isoforms (isoform 2 and isoform 5).

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.