Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Syntaxin-binding protein 4

Gene

Stxbp4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane. Inhibits the translocation of SLC2A4 from intracellular vesicles to the plasma membrane by STX4A binding and preventing the interaction between STX4A and VAMP2. Stimulation with insulin disrupts the interaction with STX4A, leading to increased levels of SLC2A4 at the plasma membrane. May also play a role in the regulation of insulin release by pancreatic beta cells after stimulation by glucose.2 Publications

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Syntaxin-binding protein 4
Alternative name(s):
Syntaxin 4-interacting protein
Short name:
STX4-interacting protein
Short name:
Synip
Gene namesi
Name:Stxbp4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1342296. Stxbp4.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi97 – 971S → F: No effect. 1 Publication
Mutagenesisi99 – 991S → F: Abolishes phosphorylation by PKB/AKT2. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 557557Syntaxin-binding protein 4PRO_0000076331Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei10 – 101PhosphoserineBy similarity
Modified residuei99 – 991Phosphoserine; by PKB/AKT2Combined sources1 Publication

Post-translational modificationi

Phosphorylated on Ser-99 by PKB/AKT2 after insulin treatment. Phosphorylation on Ser-99 abolishes the interaction with STX4A.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9WV89.
PaxDbiQ9WV89.
PRIDEiQ9WV89.

PTM databases

iPTMnetiQ9WV89.
PhosphoSiteiQ9WV89.

Expressioni

Tissue specificityi

Detected in skeletal muscle, heart, testis, adipocytes and pancreatic islet cells.2 Publications

Gene expression databases

BgeeiQ9WV89.
CleanExiMM_STXBP4.
ExpressionAtlasiQ9WV89. baseline and differential.
GenevisibleiQ9WV89. MM.

Interactioni

Subunit structurei

Interacts with STX4A.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi203567. 1 interaction.
STRINGi10090.ENSMUSP00000116191.

Structurei

Secondary structure

1
557
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi20 – 256Combined sources
Beta strandi33 – 375Combined sources
Beta strandi39 – 435Combined sources
Beta strandi45 – 528Combined sources
Helixi57 – 615Combined sources
Beta strandi69 – 735Combined sources
Helixi83 – 9210Combined sources
Beta strandi96 – 994Combined sources
Beta strandi101 – 1066Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1WI4NMR-A12-107[»]
ProteinModelPortaliQ9WV89.
SMRiQ9WV89. Positions 13-113, 502-534.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9WV89.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini19 – 10587PDZPROSITE-ProRule annotationAdd
BLAST
Domaini500 – 53334WWPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili298 – 408111Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 WW domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410IHFN. Eukaryota.
ENOG41103DM. LUCA.
GeneTreeiENSGT00390000002226.
HOGENOMiHOG000015395.
HOVERGENiHBG058016.
InParanoidiQ9WV89.
KOiK15302.
OMAiHFVETIQ.
OrthoDBiEOG7B5WVP.
PhylomeDBiQ9WV89.
TreeFamiTF331084.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
2.30.42.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR001478. PDZ.
IPR001202. WW_dom.
[Graphical view]
PfamiPF00595. PDZ. 1 hit.
PF00397. WW. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
SM00456. WW. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
SSF51045. SSF51045. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
PS01159. WW_DOMAIN_1. 1 hit.
PS50020. WW_DOMAIN_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9WV89-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDGTASARS SSPLDRDPAF RVITVTKETG LGLKILGGIN RNEGPLVYIH
60 70 80 90 100
EVIPGGDCYK DGRLKPGDQL VSINKESMIG VSFEEAKSII TRAKLRSESP
110 120 130 140 150
WEIAFIRQKS YCGHPGNICC PSPQVSEDCG PQTSTFTLLS SPSETLLPKT
160 170 180 190 200
SSTPQTQDST FPSCKAIQTK PEHDKTEHSP ITSLDNSPAD TSNADIAPAW
210 220 230 240 250
TDDDSGPQGK ISLNPSVRLK AEKLEMALNY LGIQPTKEQR EALREQVQAD
260 270 280 290 300
SKGTVSFGDF VQVARSLFCL QLDEVNVGVH EIPSILDSQL LPCDSLEADE
310 320 330 340 350
VGKLRQERNA ALEERNVLKE KLLESEKHRK QLIEELQNVK QEAKAVAEET
360 370 380 390 400
RALRSRIHLA EAAQRQAHGM EMDYEEVIRL LEAEVSELKA QLADYSDQNK
410 420 430 440 450
ESVQDLRKRV TVLDCQLRKS EMARKAFKAS TERLLGFIEA IQEVLLDSSA
460 470 480 490 500
PLSTLSERRA VLASQTSLPL LARNGRSFPA TLLLESKELV RSVRAILDMD
510 520 530 540 550
CLPYGWEEAY TADGIKYFIN HVTQTTSWIH PVMSALNLSC AEESEEDCPR

ELTDPKS
Length:557
Mass (Da):61,689
Last modified:November 1, 1999 - v1
Checksum:i9211A8B02AF8EC86
GO
Isoform 2 (identifier: Q9WV89-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     502-557: LPYGWEEAYT...CPRELTDPKS → KLSLSSSSSPSSSSSFSSSSSCNLLNKAEERP

Show »
Length:533
Mass (Da):58,592
Checksum:i8B6BC19511E3AF09
GO
Isoform 3 (identifier: Q9WV89-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     195-226: DIAPAWTDDDSGPQGKISLNPSVRLKAEKLEM → AHMERKKRHESSGQSKMWHWSCSMMKVEVFIP
     227-557: Missing.

Note: Gene prediction based on EST data.
Show »
Length:226
Mass (Da):24,737
Checksum:iE2E140A0A7A842B9
GO
Isoform 4 (identifier: Q9WV89-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     520-520: N → K
     521-557: Missing.

Note: Gene prediction based on EST data.
Show »
Length:520
Mass (Da):57,578
Checksum:i9EE892BC2EA81AC9
GO
Isoform 5 (identifier: Q9WV89-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-258: ALNYLGIQPTKEQREALREQVQADSKGTVSFG → VNPLKKNHFLHKTAGKNCLVLGEEDIGESLVS
     259-557: Missing.

Note: Gene prediction based on EST data.
Show »
Length:258
Mass (Da):27,803
Checksum:i4ECDEC95F5B7A7F5
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei195 – 22632DIAPA…EKLEM → AHMERKKRHESSGQSKMWHW SCSMMKVEVFIP in isoform 3. CuratedVSP_017179Add
BLAST
Alternative sequencei227 – 557331Missing in isoform 3. CuratedVSP_017180Add
BLAST
Alternative sequencei227 – 25832ALNYL…TVSFG → VNPLKKNHFLHKTAGKNCLV LGEEDIGESLVS in isoform 5. CuratedVSP_017181Add
BLAST
Alternative sequencei259 – 557299Missing in isoform 5. CuratedVSP_017182Add
BLAST
Alternative sequencei502 – 55756LPYGW…TDPKS → KLSLSSSSSPSSSSSFSSSS SCNLLNKAEERP in isoform 2. 1 PublicationVSP_017183Add
BLAST
Alternative sequencei520 – 5201N → K in isoform 4. 1 PublicationVSP_017184
Alternative sequencei521 – 55737Missing in isoform 4. 1 PublicationVSP_017185Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF152924 mRNA. Translation: AAD43533.1.
AL646046 Genomic DNA. Translation: CAI23907.1.
AL646046 Genomic DNA. Translation: CAI23908.1.
AL646046 Genomic DNA. Translation: CAI23909.1.
AL646046 Genomic DNA. Translation: CAI23910.1.
AL646046 Genomic DNA. Translation: CAI23911.1.
BC032881 mRNA. Translation: AAH32881.1.
AK138499 mRNA. Translation: BAE23686.1.
CCDSiCCDS25242.1. [Q9WV89-1]
RefSeqiNP_035635.1. NM_011505.2. [Q9WV89-1]
UniGeneiMm.207203.

Genome annotation databases

EnsembliENSMUST00000020858; ENSMUSP00000020858; ENSMUSG00000020546. [Q9WV89-2]
ENSMUST00000107872; ENSMUSP00000103504; ENSMUSG00000020546. [Q9WV89-3]
ENSMUST00000107875; ENSMUSP00000103507; ENSMUSG00000020546. [Q9WV89-5]
ENSMUST00000143203; ENSMUSP00000116191; ENSMUSG00000020546. [Q9WV89-1]
GeneIDi20913.
KEGGimmu:20913.
UCSCiuc007kwu.2. mouse. [Q9WV89-1]
uc007kwx.2. mouse. [Q9WV89-2]
uc007kwy.2. mouse. [Q9WV89-5]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF152924 mRNA. Translation: AAD43533.1.
AL646046 Genomic DNA. Translation: CAI23907.1.
AL646046 Genomic DNA. Translation: CAI23908.1.
AL646046 Genomic DNA. Translation: CAI23909.1.
AL646046 Genomic DNA. Translation: CAI23910.1.
AL646046 Genomic DNA. Translation: CAI23911.1.
BC032881 mRNA. Translation: AAH32881.1.
AK138499 mRNA. Translation: BAE23686.1.
CCDSiCCDS25242.1. [Q9WV89-1]
RefSeqiNP_035635.1. NM_011505.2. [Q9WV89-1]
UniGeneiMm.207203.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1WI4NMR-A12-107[»]
ProteinModelPortaliQ9WV89.
SMRiQ9WV89. Positions 13-113, 502-534.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi203567. 1 interaction.
STRINGi10090.ENSMUSP00000116191.

PTM databases

iPTMnetiQ9WV89.
PhosphoSiteiQ9WV89.

Proteomic databases

MaxQBiQ9WV89.
PaxDbiQ9WV89.
PRIDEiQ9WV89.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000020858; ENSMUSP00000020858; ENSMUSG00000020546. [Q9WV89-2]
ENSMUST00000107872; ENSMUSP00000103504; ENSMUSG00000020546. [Q9WV89-3]
ENSMUST00000107875; ENSMUSP00000103507; ENSMUSG00000020546. [Q9WV89-5]
ENSMUST00000143203; ENSMUSP00000116191; ENSMUSG00000020546. [Q9WV89-1]
GeneIDi20913.
KEGGimmu:20913.
UCSCiuc007kwu.2. mouse. [Q9WV89-1]
uc007kwx.2. mouse. [Q9WV89-2]
uc007kwy.2. mouse. [Q9WV89-5]

Organism-specific databases

CTDi252983.
MGIiMGI:1342296. Stxbp4.

Phylogenomic databases

eggNOGiENOG410IHFN. Eukaryota.
ENOG41103DM. LUCA.
GeneTreeiENSGT00390000002226.
HOGENOMiHOG000015395.
HOVERGENiHBG058016.
InParanoidiQ9WV89.
KOiK15302.
OMAiHFVETIQ.
OrthoDBiEOG7B5WVP.
PhylomeDBiQ9WV89.
TreeFamiTF331084.

Miscellaneous databases

EvolutionaryTraceiQ9WV89.
NextBioi299809.
PROiQ9WV89.
SOURCEiSearch...

Gene expression databases

BgeeiQ9WV89.
CleanExiMM_STXBP4.
ExpressionAtlasiQ9WV89. baseline and differential.
GenevisibleiQ9WV89. MM.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
2.30.42.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR001478. PDZ.
IPR001202. WW_dom.
[Graphical view]
PfamiPF00595. PDZ. 1 hit.
PF00397. WW. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
SM00456. WW. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
SSF51045. SSF51045. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
PS01159. WW_DOMAIN_1. 1 hit.
PS50020. WW_DOMAIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Synip: a novel insulin-regulated syntaxin 4-binding protein mediating GLUT4 translocation in adipocytes."
    Min J., Okada S., Kanzaki M., Elmendorf J.S., Coker K.J., Ceresa B.P., Syu L.-J., Noda Y., Saltiel A.R., Pessin J.E.
    Mol. Cell 3:751-760(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH STX4A, TISSUE SPECIFICITY.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Thymus.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 368-557 (ISOFORM 4).
    Strain: C57BL/6J.
    Tissue: Spinal cord.
  5. "Syntaxin 4 and Synip (syntaxin 4 interacting protein) regulate insulin secretion in the pancreatic beta HC-9 cell."
    Saito T., Okada S., Yamada E., Ohshima K., Shimizu H., Shimomura K., Sato M., Pessin J.E., Mori M.
    J. Biol. Chem. 278:36718-36725(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  6. "Akt2 phosphorylates Synip to regulate docking and fusion of GLUT4-containing vesicles."
    Yamada E., Okada S., Saito T., Ohshima K., Sato M., Tsuchiya T., Uehara Y., Shimizu H., Mori M.
    J. Cell Biol. 168:921-928(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-99, MUTAGENESIS OF SER-97 AND SER-99.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-99, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Kidney, Lung and Spleen.
  8. "Solution structure of the PDZ domain of syntaxin binding protein 4."
    RIKEN structural genomics initiative (RSGI)
    Submitted (JUN-2005) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 12-107.

Entry informationi

Entry nameiSTXB4_MOUSE
AccessioniPrimary (citable) accession number: Q9WV89
Secondary accession number(s): Q5SUA6
, Q5SUA8, Q5SUA9, Q8CFL1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: November 1, 1999
Last modified: May 11, 2016
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.