Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-like protein KIF2A

Gene

Kif2a

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Plus end-directed microtubule-dependent motor required for normal brain development. May regulate microtubule dynamics during axonal growth. Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate. Required for normal spindle dynamics during mitosis. Promotes spindle turnover. Implicated in formation of bipolar mitotic spindles. Has microtubule depolymerization activity (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi312 – 3198ATPPROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Motor protein

Keywords - Biological processi

Cell cycle, Cell division, Differentiation, Mitosis, Neurogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF2A
Alternative name(s):
Kinesin-2
Gene namesi
Name:Kif2aBy similarity
Synonyms:Kif2Imported
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi70974. Kif2a.

Subcellular locationi

  • Cytoplasm By similarity
  • Cytoplasmcytoskeletonmicrotubule organizing centercentrosome By similarity
  • Cytoplasmcytoskeletonspindle pole By similarity
  • Cytoplasmcytoskeletonspindle By similarity

  • Note: Localized to the spindle microtubules and spindle poles from prophase to metaphase. Efficient targeting to spindle microtubules and spindle poles requires the kinase activity of PLK1. Recruited to mitotic spindles by interaction with PSRC1 (By similarity).By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 705705Kinesin-like protein KIF2APRO_0000306273Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei20 – 201PhosphoserineBy similarity
Modified residuei75 – 751PhosphoserineCombined sources
Modified residuei101 – 1011N6-acetyllysineBy similarity
Modified residuei139 – 1391PhosphoserineBy similarity
Isoform 21 Publication (identifier: Q9WV63-2)
Modified residuei572 – 5721PhosphoserineCombined sourcesCurated

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PRIDEiQ9WV63.

PTM databases

iPTMnetiQ9WV63.
PhosphoSiteiQ9WV63.

Interactioni

Subunit structurei

Interacts with AURKA, PSRC1 and PLK1.By similarity

Protein-protein interaction databases

IntActiQ9WV63. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ9WV63.
SMRiQ9WV63. Positions 195-549.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini222 – 552331Kinesin motorPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili153 – 18634Sequence analysisAdd
BLAST
Coiled coili659 – 69840Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. MCAK/KIF2 subfamily.PROSITE-ProRule annotation
Contains 1 kinesin motor domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

HOGENOMiHOG000231329.
HOVERGENiHBG003875.
InParanoidiQ9WV63.
PhylomeDBiQ9WV63.

Family and domain databases

Gene3Di3.40.850.10. 1 hit.
InterProiIPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 2 hits.
PfamiPF00225. Kinesin. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00129. KISc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q9WV63-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATANFGKIQ IGIYVEIKRS DGRIHQAMVT SLNEDNESVT VEWIENGDTK
60 70 80 90 100
GKEIDLESIF SLNPDLVPDE DIEPSPEIPP PSSSSKVNKI VKNRRTVASI
110 120 130 140 150
KNDPPPRDNR VVGSARARPS QLPEQSSSAQ QNGSVSDISP VQAAKKEFGP
160 170 180 190 200
PSRRKSNCVK EVEKLQEKRE KRRLQQQELR EKRAQDVDAT NPNYEIMCMI
210 220 230 240 250
RDFRGSLDYR PLTTADPIDE HRICVCVRKR PLNKKETQMK DLDVITIPSK
260 270 280 290 300
DVVMVHEPKQ KVDLTRYLEN QTFRFDYAFD DSAPNEMVYR FTARPLVETI
310 320 330 340 350
FERGMATCFA YGQTGSGKTH TMGGDCSGKN QDCSKGIYAL AARDVFLMLK
360 370 380 390 400
KPNYKKLELQ VYATFFEIYS GKVFDLLNRK TKLRVLEDGK QQVQVVGLQE
410 420 430 440 450
REVKCVEDVL KLIDIGNSCR TSGQTSANAH SSRSHAVFQI ILRRKGKLHG
460 470 480 490 500
KFSLIDLAGN ERGADTSSAD RQTRLEGAEI NKSLLALKEC IRALGRNKPH
510 520 530 540 550
TPFRASKLTQ VLRDSFIGEN SRTCMIATIS PGMASCENTL NTLRYANRVK
560 570 580 590 600
ELTVDPTAAG DVRPIMHHPP SQIDDLETQW GVGSSPQRDD LKLLCEQNEE
610 620 630 640 650
EVSPQLFTFH EAVSQMVEME EQVVEDHRAV FQESIRWIED EKALLEMTEE
660 670 680 690 700
VDYDVDSYAT QLEAILEQKI DILTELRDKV KSFRAALQEE EQASKQINPK

RPRAL
Note: Incomplete sequence.Curated
Length:705
Mass (Da):79,792
Last modified:October 2, 2007 - v2
Checksum:i7B6A50DB6B27B6DA
GO
Isoform 21 Publication (identifier: Q9WV63-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     551-551: E → EFGISPSDIPFSQGSGSRPDLSPSYDYDDFSPSITRVKE

Note: Incomplete sequence.Combined sourcesCurated
Show »
Length:743
Mass (Da):83,927
Checksum:i9D1C1C7FAF20493A
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei551 – 5511E → EFGISPSDIPFSQGSGSRPD LSPSYDYDDFSPSITRVKE in isoform 2. 1 PublicationVSP_052553

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC105687 Genomic DNA. No translation available.
AF155824 mRNA. Translation: AAD39241.1.
BC091304 mRNA. Translation: AAH91304.1.
UniGeneiRn.218992.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC105687 Genomic DNA. No translation available.
AF155824 mRNA. Translation: AAD39241.1.
BC091304 mRNA. Translation: AAH91304.1.
UniGeneiRn.218992.

3D structure databases

ProteinModelPortaliQ9WV63.
SMRiQ9WV63. Positions 195-549.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9WV63. 1 interaction.

PTM databases

iPTMnetiQ9WV63.
PhosphoSiteiQ9WV63.

Proteomic databases

PRIDEiQ9WV63.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

RGDi70974. Kif2a.

Phylogenomic databases

HOGENOMiHOG000231329.
HOVERGENiHBG003875.
InParanoidiQ9WV63.
PhylomeDBiQ9WV63.

Miscellaneous databases

PROiQ9WV63.

Family and domain databases

Gene3Di3.40.850.10. 1 hit.
InterProiIPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 2 hits.
PfamiPF00225. Kinesin. 1 hit.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00129. KISc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Genome sequence of the Brown Norway rat yields insights into mammalian evolution."
    Gibbs R.A., Weinstock G.M., Metzker M.L., Muzny D.M., Sodergren E.J., Scherer S., Scott G., Steffen D., Worley K.C., Burch P.E., Okwuonu G., Hines S., Lewis L., Deramo C., Delgado O., Dugan-Rocha S., Miner G., Morgan M.
    , Hawes A., Gill R., Holt R.A., Adams M.D., Amanatides P.G., Baden-Tillson H., Barnstead M., Chin S., Evans C.A., Ferriera S., Fosler C., Glodek A., Gu Z., Jennings D., Kraft C.L., Nguyen T., Pfannkoch C.M., Sitter C., Sutton G.G., Venter J.C., Woodage T., Smith D., Lee H.-M., Gustafson E., Cahill P., Kana A., Doucette-Stamm L., Weinstock K., Fechtel K., Weiss R.B., Dunn D.M., Green E.D., Blakesley R.W., Bouffard G.G., De Jong P.J., Osoegawa K., Zhu B., Marra M., Schein J., Bosdet I., Fjell C., Jones S., Krzywinski M., Mathewson C., Siddiqui A., Wye N., McPherson J., Zhao S., Fraser C.M., Shetty J., Shatsman S., Geer K., Chen Y., Abramzon S., Nierman W.C., Havlak P.H., Chen R., Durbin K.J., Egan A., Ren Y., Song X.-Z., Li B., Liu Y., Qin X., Cawley S., Cooney A.J., D'Souza L.M., Martin K., Wu J.Q., Gonzalez-Garay M.L., Jackson A.R., Kalafus K.J., McLeod M.P., Milosavljevic A., Virk D., Volkov A., Wheeler D.A., Zhang Z., Bailey J.A., Eichler E.E., Tuzun E., Birney E., Mongin E., Ureta-Vidal A., Woodwark C., Zdobnov E., Bork P., Suyama M., Torrents D., Alexandersson M., Trask B.J., Young J.M., Huang H., Wang H., Xing H., Daniels S., Gietzen D., Schmidt J., Stevens K., Vitt U., Wingrove J., Camara F., Mar Alba M., Abril J.F., Guigo R., Smit A., Dubchak I., Rubin E.M., Couronne O., Poliakov A., Huebner N., Ganten D., Goesele C., Hummel O., Kreitler T., Lee Y.-A., Monti J., Schulz H., Zimdahl H., Himmelbauer H., Lehrach H., Jacob H.J., Bromberg S., Gullings-Handley J., Jensen-Seaman M.I., Kwitek A.E., Lazar J., Pasko D., Tonellato P.J., Twigger S., Ponting C.P., Duarte J.M., Rice S., Goodstadt L., Beatson S.A., Emes R.D., Winter E.E., Webber C., Brandt P., Nyakatura G., Adetobi M., Chiaromonte F., Elnitski L., Eswara P., Hardison R.C., Hou M., Kolbe D., Makova K., Miller W., Nekrutenko A., Riemer C., Schwartz S., Taylor J., Yang S., Zhang Y., Lindpaintner K., Andrews T.D., Caccamo M., Clamp M., Clarke L., Curwen V., Durbin R.M., Eyras E., Searle S.M., Cooper G.M., Batzoglou S., Brudno M., Sidow A., Stone E.A., Payseur B.A., Bourque G., Lopez-Otin C., Puente X.S., Chakrabarti K., Chatterji S., Dewey C., Pachter L., Bray N., Yap V.B., Caspi A., Tesler G., Pevzner P.A., Haussler D., Roskin K.M., Baertsch R., Clawson H., Furey T.S., Hinrichs A.S., Karolchik D., Kent W.J., Rosenbloom K.R., Trumbower H., Weirauch M., Cooper D.N., Stenson P.D., Ma B., Brent M., Arumugam M., Shteynberg D., Copley R.R., Taylor M.S., Riethman H., Mudunuri U., Peterson J., Guyer M., Felsenfeld A., Old S., Mockrin S., Collins F.S.
    Nature 428:493-521(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Brown Norway1 Publication.
  2. "Rat kinesin probes to use for Northern blot analysis."
    Gould R.M., Freund C.M., Hawkins G.A.
    Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 497-705 (ISOFORM 2).
    Tissue: BrainImported.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 502-705 (ISOFORM 1).
    Tissue: OvaryImported.
  4. "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues."
    Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V.
    Nat. Commun. 3:876-876(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-75, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-572 (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiKIF2A_RAT
AccessioniPrimary (citable) accession number: Q9WV63
Secondary accession number(s): Q5BJW1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: October 2, 2007
Last modified: May 11, 2016
This is version 99 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.