Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lipolysis-stimulated lipoprotein receptor

Gene

Lsr

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable role in the clearance of triglyceride-rich lipoprotein from plasma. Binds chylomicrons, LDL and VLDL in presence of free fatty acids and allows their subsequent uptake in the cells.1 Publication

GO - Molecular functioni

  • fatty acid binding Source: HGNC
  • triglyceride binding Source: HGNC

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Names & Taxonomyi

Protein namesi
Recommended name:
Lipolysis-stimulated lipoprotein receptor
Alternative name(s):
Lipolysis-stimulated remnant receptor
Gene namesi
Name:Lsr
Synonyms:Lisch7
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 1

Organism-specific databases

RGDi69236. Lsr.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini36 – 206171ExtracellularSequence analysisAdd
BLAST
Transmembranei207 – 22721HelicalSequence analysisAdd
BLAST
Topological domaini228 – 593366CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Chylomicron, LDL, Membrane, VLDL

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3535Sequence analysisAdd
BLAST
Chaini36 – 593558Lipolysis-stimulated lipoprotein receptorPRO_0000245310Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi113 ↔ 165By similarity
Modified residuei283 – 2831PhosphothreonineCombined sources
Modified residuei308 – 3081PhosphoserineBy similarity
Modified residuei314 – 3141PhosphoserineBy similarity
Modified residuei332 – 3321PhosphoserineBy similarity
Modified residuei375 – 3751PhosphoserineBy similarity
Modified residuei379 – 3791PhosphoserineBy similarity
Modified residuei396 – 3961PhosphothreonineBy similarity
Modified residuei407 – 4071PhosphoserineCombined sources
Modified residuei410 – 4101PhosphoserineBy similarity
Modified residuei436 – 4361PhosphoserineCombined sources
Modified residuei471 – 4711PhosphoserineBy similarity
Modified residuei473 – 4731PhosphoserineCombined sources
Modified residuei478 – 4781PhosphotyrosineBy similarity
Modified residuei575 – 5751PhosphoserineBy similarity
Modified residuei587 – 5871PhosphoserineBy similarity
Modified residuei590 – 5901PhosphoserineBy similarity

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

PaxDbiQ9WU74.
PRIDEiQ9WU74.

PTM databases

iPTMnetiQ9WU74.
PhosphoSiteiQ9WU74.

Expressioni

Tissue specificityi

Specifically expressed in liver. Also detected in kidney and lung.1 Publication

Gene expression databases

BgeeiENSRNOG00000021053.
GenevisibleiQ9WU74. RN.

Interactioni

Subunit structurei

Homotrimer or homotetramer constituted of isoform 1 and/or isoform 2 and isoform 3.1 Publication

Protein-protein interaction databases

IntActiQ9WU74. 1 interaction.
STRINGi10116.ENSRNOP00000041379.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini89 – 18193Ig-like V-typeAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi227 – 25125Cys-richAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IKMJ. Eukaryota.
ENOG411004A. LUCA.
GeneTreeiENSGT00430000030906.
HOGENOMiHOG000253962.
HOVERGENiHBG061576.
InParanoidiQ9WU74.
OMAiPPAMIPM.
OrthoDBiEOG091G0875.
PhylomeDBiQ9WU74.
TreeFamiTF330877.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR008664. LISCH7.
[Graphical view]
PfamiPF05624. LSR. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9WU74-1) [UniParc]FASTAAdd to basket
Also known as: alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPAAGACAG APDSHPATVV FVCLFLIIFC PDPASAIQVT VSDPYHVVIL
60 70 80 90 100
FQPVTLPCTY QMSNTLTVPI VIWKYKSFCR DRIADAFSPA SVDNQLNAQL
110 120 130 140 150
AAGNPGYNPY VECQDSVRTV RVVATKQGNA VTLGDYYQGR RITITGNADL
160 170 180 190 200
TFEQTAWGDS GVYYCSVVSA QDLDGNNEAY AELIVLGRTS EAPELLPGFR
210 220 230 240 250
AGPLEDWLFV VVVCLASLLL FLLLGICWCQ CCPHTCCCYV RCPCCPDKCC
260 270 280 290 300
CPEALYAAGK AATSGVPSIY APSIYTHLSP AKTPPPPPAM IPMGPPYGYP
310 320 330 340 350
GDFDRHSSVG GHSSQVPLLR DVDGSVSSEV RSGYRIQANQ QDDSMRVLYY
360 370 380 390 400
MEKELANFDP SRPGPPNGRV ERAMSEVTSL HEDDWRSRPS RAPALTPIRD
410 420 430 440 450
EEWNRHSPQS PRTWEQEPLQ EQPRGGWGSG RPRARSVDAL DDINRPGSTE
460 470 480 490 500
SGRSSPPSSG RRGRAYAPPR SRSRDDLYDP DDPRDLPHSR DPHYYDDIRS
510 520 530 540 550
RDPRADPRSR QRSRDPRDAG FRSRDPQYDG RLLEEALKKK GSGERRRVYR
560 570 580 590
EEEEEEEGQY PPAPPPYSET DSQASRERRL KKNLALSRES LVV
Length:593
Mass (Da):65,777
Last modified:November 1, 1999 - v1
Checksum:i7C0288823492C87F
GO
Isoform 2 (identifier: Q9WU74-2) [UniParc]FASTAAdd to basket
Also known as: alpha'

The sequence of this isoform differs from the canonical sequence as follows:
     187-205: Missing.

Show »
Length:574
Mass (Da):63,797
Checksum:i23850648D4D056DD
GO
Isoform 3 (identifier: Q9WU74-3) [UniParc]FASTAAdd to basket
Also known as: beta

The sequence of this isoform differs from the canonical sequence as follows:
     187-255: GRTSEAPELLPGFRAGPLEDWLFVVVVCLASLLLFLLLGICWCQCCPHTCCCYVRCPCCPDKCCCPEAL → V

Show »
Length:525
Mass (Da):58,311
Checksum:i8E62038B96B30D15
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti481 – 4811D → E in AAI00627 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei187 – 25569GRTSE…CPEAL → V in isoform 3. 1 PublicationVSP_019697Add
BLAST
Alternative sequencei187 – 20519Missing in isoform 2. 2 PublicationsVSP_019698Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF119667 mRNA. Translation: AAD30028.1.
AF119668 mRNA. Translation: AAD30029.1.
AF119669 mRNA. Translation: AAD30030.1.
BC100626 mRNA. Translation: AAI00627.1.
RefSeqiNP_116005.1. NM_032616.1. [Q9WU74-1]
XP_006228906.1. XM_006228844.2. [Q9WU74-2]
XP_006228907.1. XM_006228845.2. [Q9WU74-3]
UniGeneiRn.48696.

Genome annotation databases

EnsembliENSRNOT00000028585; ENSRNOP00000028585; ENSRNOG00000021053. [Q9WU74-2]
ENSRNOT00000044678; ENSRNOP00000041379; ENSRNOG00000021053. [Q9WU74-1]
GeneIDi64355.
KEGGirno:64355.
UCSCiRGD:69236. rat. [Q9WU74-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF119667 mRNA. Translation: AAD30028.1.
AF119668 mRNA. Translation: AAD30029.1.
AF119669 mRNA. Translation: AAD30030.1.
BC100626 mRNA. Translation: AAI00627.1.
RefSeqiNP_116005.1. NM_032616.1. [Q9WU74-1]
XP_006228906.1. XM_006228844.2. [Q9WU74-2]
XP_006228907.1. XM_006228845.2. [Q9WU74-3]
UniGeneiRn.48696.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9WU74. 1 interaction.
STRINGi10116.ENSRNOP00000041379.

PTM databases

iPTMnetiQ9WU74.
PhosphoSiteiQ9WU74.

Proteomic databases

PaxDbiQ9WU74.
PRIDEiQ9WU74.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000028585; ENSRNOP00000028585; ENSRNOG00000021053. [Q9WU74-2]
ENSRNOT00000044678; ENSRNOP00000041379; ENSRNOG00000021053. [Q9WU74-1]
GeneIDi64355.
KEGGirno:64355.
UCSCiRGD:69236. rat. [Q9WU74-1]

Organism-specific databases

CTDi51599.
RGDi69236. Lsr.

Phylogenomic databases

eggNOGiENOG410IKMJ. Eukaryota.
ENOG411004A. LUCA.
GeneTreeiENSGT00430000030906.
HOGENOMiHOG000253962.
HOVERGENiHBG061576.
InParanoidiQ9WU74.
OMAiPPAMIPM.
OrthoDBiEOG091G0875.
PhylomeDBiQ9WU74.
TreeFamiTF330877.

Miscellaneous databases

PROiQ9WU74.

Gene expression databases

BgeeiENSRNOG00000021053.
GenevisibleiQ9WU74. RN.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR008664. LISCH7.
[Graphical view]
PfamiPF05624. LSR. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiLSR_RAT
AccessioniPrimary (citable) accession number: Q9WU74
Secondary accession number(s): Q497B9, Q9WU75, Q9WU76
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: November 1, 1999
Last modified: September 7, 2016
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.