Reviewed,
UniProtKB/Swiss-Prot Q9WTU6 (MK09_MOUSE)
Last modified
February 9, 2010.
Version 106.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Mitogen-activated protein kinase 9 Short name=MAP kinase 9 Short name=MAPK 9 EC=2.7.11.24 Alternative name(s): Stress-activated protein kinase JNK2 c-Jun N-terminal kinase 2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 423 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating a number of transcription factors, primarily components of AP-1 such as c-Jun and ATF2 and thus regulates AP-1 transcriptional activity. In T-cells, JNK1 and JNK2 are required for polarized differentiation of T-helper cells into Th1 cells. Ref.1 Ref.7 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium By similarity. |
| Enzyme regulation | Activated by threonine and tyrosine phosphorylation by either of two dual specificity kinases, MAP2K4 and MAP2K7. Inhibited by dual specificity phosphatases, such as DUSP1. Ref.7 |
| Subunit structure | Interacts with MECOM By similarity. Binds to at least four scaffolding proteins, MAPK8IP1/JIP-1, MAPK8IP2/JIP-2, MAPK8IP3/JIP-3/JSAP1 and SPAG9/MAPK8IP4/JIP-4. These proteins also bind other components of the JNK signaling pathway. Interacts with NFATC4. |
| Tissue specificity | All four isoforms are widely distributed in brain. Isoforms alpha-1 and alpha-2 are predominantly expressed in hippocampus, cerebral cortex, caudate-putamen, amygdala and the granule layer of the cerebellum. Alpha-1 is more abundant than alpha-2 in the periaqueductal region and the substantia nigra. Ref.3 |
| Induction | In T-cells, following T-cell receptor (TCR) activation. Levels peak 48 hours after TCR and CD-28 costimulation. Ref.1 Ref.7 |
| Domain | The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases. |
| Post-translational modification | Dually phosphorylated on Thr-183 and Tyr-185, which activates the enzyme. Ref.9 Ref.10 |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | JNK cascade Ref.7 Inferred from sequence or structural similarity. Source: UniProtKB induction of apoptosis in response to chemical stimulusInferred from genetic interaction. Source: MGI protein amino acid phosphorylationInferred from electronic annotation. Source: InterPro response to cadmium ionInferred from genetic interaction. Source: MGI |
| Cellular component | nucleus Ref.7 Inferred by curator. Source: UniProtKB |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW JUN kinase activity Ref.7Inferred from sequence or structural similarity. Source: UniProtKB protein bindingInferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Alpha-2 (identifier: Q9WTU6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Alpha-1 (identifier: Q9WTU6-2) The sequence of this isoform differs from the canonical sequence as follows: 377-423: DAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLEGCR → AQMQQ | ||||||
| Isoform Beta-1 (identifier: Q9WTU6-3) The sequence of this isoform differs from the canonical sequence as follows: 216-230: AEMVLHKVLFPGRDY → GELVKGCVIFQGTDH 377-423: DAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLEGCR → AQMQQ | ||||||
| Isoform Beta-2 (identifier: Q9WTU6-4) The sequence of this isoform differs from the canonical sequence as follows: 216-230: AEMVLHKVLFPGRDY → GELVKGCVIFQGTDH |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 423 | 423 | Mitogen-activated protein kinase 9 | PRO_0000186274 | |||||
Regions | |||||||||
| Domain | 26 – 321 | 296 | Protein kinase | ||||||
| Nucleotide binding | 33 – 38 | 6 | ATP By similarity | ||||||
| Motif | 183 – 185 | 3 | TXY | ||||||
Sites | |||||||||
| Active site | 151 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 55 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 183 | 1 | Phosphothreonine Ref.9 | ||||||
| Modified residue | 185 | 1 | Phosphotyrosine Ref.9 Ref.10 | ||||||
| Modified residue | 403 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 216 – 230 | 15 | AEMVL…PGRDY → GELVKGCVIFQGTDH in isoform Beta-1 and isoform Beta-2. | VSP_004836 | |||||
| Alternative sequence | 377 – 423 | 47 | DAAVS…LEGCR → AQMQQ in isoform Alpha-1 and isoform Beta-1. | VSP_004837 | |||||
Experimental info | |||||||||
| Sequence conflict | 223 | 1 | V → C Ref.3 | ||||||
| Sequence conflict | 237 | 1 | V → A in CAC88132. Ref.3 | ||||||
| Sequence conflict | 386 | 1 | P → A in BAC27623. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Differentiation of CD4+ T cells to Th1 cells requires MAP kinase JNK2." Yang D.D., Conze D., Whitmarsh A.J., Barrett T., Davis R.J., Rincon M., Flavell R.A. Immunity 9:575-585(1998) [PubMed: 9806643] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-1; ALPHA-2; BETA-1 AND BETA-2), FUNCTION, INDUCTION. |
| [2] | "JSAP1, a novel jun N-terminal protein kinase (JNK)-binding protein that functions as a scaffold factor in the JNK signaling pathway." Ito M., Yoshioka K., Akechi M., Yamashita S., Takamatsu N., Sugiyama K., Hibi M., Nakabeppu Y., Shiba T., Yamamoto K. Mol. Cell. Biol. 19:7539-7548(1999) [PubMed: 10523642] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA-1). Tissue: Brain. |
| [3] | "Analysis of splicing of four mouse JNK/SAPKalpha variants." Casanova E., Callejo A.I., Calvo P., Chinchetru M.A. NeuroReport 11:305-309(2000) [PubMed: 10674476] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS ALPHA-1; ALPHA-2; BETA-1 AND BETA-2), TISSUE SPECIFICITY. Tissue: Liver. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BETA-2). Strain: C57BL/6J. Tissue: Medulla oblongata. |
| [5] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BETA-2). Strain: FVB/N. Tissue: Salivary gland. |
| [7] | "JNK is required for effector T-cell function but not for T-cell activation." Dong C., Yang D.D., Tournier C., Whitmarsh A.J., Xu J., Davis R.J., Flavell R.A. Nature 405:91-94(2000) [PubMed: 10811224] [Abstract] Cited for: FUNCTION, ENZYME REGULATION, INDUCTION. Tissue: Embryonic stem cell and T-cell. |
| [8] | "Requirement of the JIP1 scaffold protein for stress-induced JNK activation." Whitmarsh A.J., Kuan C.-Y., Kennedy N.J., Kelkar N., Haydar T.F., Mordes J.P., Appel M., Rossini A.A., Jones S.N., Flavell R.A., Rakic P., Davis R.J. Genes Dev. 15:2421-2432(2001) [PubMed: 11562351] [Abstract] Cited for: SUBUNIT. Tissue: Hippocampus. |
| [9] | "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain." Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P. J. Proteome Res. 7:311-318(2008) [PubMed: 18034455] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-183 AND TYR-185, MASS SPECTROMETRY. Tissue: Brain. |
| [10] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed: 17242355] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-185, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF052466 mRNA. Translation: AAD22576.1. AF052467 mRNA. Translation: AAD22577.1. AF052468 mRNA. Translation: AAD22578.1. AF052469 mRNA. Translation: AAD22579.1. AB005664 mRNA. Translation: BAA85876.1. AJ315339 AJ315350 Genomic DNA. Translation: CAC88132.1. Sequence problems.AK031959 mRNA. Translation: BAC27623.1. AL606479 Genomic DNA. Translation: CAI23940.1. AL606479 Genomic DNA. Translation: CAI23941.1. BC028341 mRNA. Translation: AAH28341.1. |
| IPI | IPI00123875. IPI00223339. IPI00223340. IPI00223342. |
| RefSeq | NP_001157143.1. NP_001157144.1. NP_058657.1. NP_997575.2. |
| UniGene | Mm.68933 |
3D structure databases | |
| SMR | Q9WTU6. Positions 7-362. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9WTU6. 4 interactions. |
| STRING | Q9WTU6. |
PTM databases | |
| PhosphoSite | Q9WTU6. |
2-D gel databases | |
| PMMA-2DPAGE | Q9WTU6. |
Proteomic databases | |
| PRIDE | Q9WTU6. |
Genome annotation databases | |
| Ensembl | ENSMUST00000020634; ENSMUSP00000020634; ENSMUSG00000020366; Mus musculus. [Genome view] ENSMUST00000043321; ENSMUSP00000042744; ENSMUSG00000020366; Mus musculus. [Genome view] ENSMUST00000109179; ENSMUSP00000104808; ENSMUSG00000020366; Mus musculus. [Genome view] |
| GeneID | 26420. |
| KEGG | mmu:26420. |
| UCSC | uc007irf.1. mouse. uc007irg.1. mouse. uc007irh.1. mouse. uc007iri.1. mouse. |
Organism-specific databases | |
| CTD | 26420. |
| MGI | MGI:1346862. Mapk9. |
Phylogenomic databases | |
| HOVERGEN | Q9WTU6. |
| OMA | NGVVKDQ. |
| PhylomeDB | Q9WTU6. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.24. 244. |
Gene expression databases | |
| ArrayExpress | Q9WTU6. |
| Bgee | Q9WTU6. |
| CleanEx | MM_MAPK9. |
| Genevestigator | Q9WTU6. |
| GermOnline | ENSMUSG00000020366. Mus musculus. |
Family and domain databases | |
| InterPro | IPR008351. JNK_MAPK. IPR011009. Kinase-like_dom. IPR003527. MAP_kinase_CS. IPR000719. Prot_kinase_cat_dom. IPR017442. Se/Thr_prot_kinase-like_dom. IPR008271. Ser/Thr_prot_kinase_AS. IPR002290. Ser/Thr_prot_kinase_dom. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| PRINTS | PR01772. JNKMAPKINASE. |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| PROSITE | PS01351. MAPK. 1 hit. PS00107. PROTEIN_KINASE_ATP. False negative. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 304437. |
| SOURCE | Search... |
Entry information
| Entry name | MK09_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9WTU6 Secondary accession number(s): Q5NCK9 Q9WTU5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


