Q9WTU6 (MK09_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 133.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mitogen-activated protein kinase 9 Short name=MAP kinase 9 Short name=MAPK 9 EC=2.7.11.24 Alternative name(s): Stress-activated protein kinase JNK2 c-Jun N-terminal kinase 2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 423 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death. Extracellular stimuli such as proinflammatory cytokines or physical stress stimulate the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. In this cascade, two dual specificity kinases MAP2K4/MKK4 and MAP2K7/MKK7 phosphorylate and activate MAPK9/JNK2. In turn, MAPK9/JNK2 phosphorylates a number of transcription factors, primarily components of AP-1 such as JUN and ATF2 and thus regulates AP-1 transcriptional activity. In response to oxidative or ribotoxic stresses, inhibits rRNA synthesis by phosphorylating and inactivating the RNA polymerase 1-specific transcription initiation factor RRN3. Promotes stressed cell apoptosis by phosphorylating key regulatory factors including TP53 and YAP1. In T-cells, MAPK8 and MAPK9 are required for polarized differentiation of T-helper cells into Th1 cells. Upon T-cell receptor (TCR) stimulation, is activated by CARMA1, BCL10, MAP2K7 and MAP3K7/TAK1 to regulate JUN protein levels. Plays an important role in the osmotic stress-induced epithelial tight-junctions disruption. When activated, promotes beta-catenin/CTNNB1 degradation and inhibits the canonical Wnt signaling pathway. Participates also in neurite growth in spiral ganglion neurons. Ref.1 Ref.7 Ref.10 Ref.13 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium By similarity. |
| Enzyme regulation | Activated by threonine and tyrosine phosphorylation by either of two dual specificity kinases, MAP2K4 and MAP2K7. MAP2K4 shows a strong preference for Tyr-185 while MAP2K7 phosphorylates Tyr-183 preferentially. Inhibited by dual specificity phosphatases, such as DUSP1. Ref.7 |
| Subunit structure | Interacts with MECOM. Binds to at least four scaffolding proteins, MAPK8IP1/JIP-1, MAPK8IP2/JIP-2, MAPK8IP3/JIP-3/JSAP1 and SPAG9/MAPK8IP4/JIP-4. These proteins also bind other components of the JNK signaling pathway. Interacts with NFATC4. Interacts with ATF7; the interaction does not phosphorylate ATF7 but acts as a docking site for ATF7-associated partners such as JUN. Interacts with BCL10. Interacts with CTNNB1 and GSK3B By similarity. Interacts with DCLK2. Ref.8 Ref.9 |
| Subcellular location | |
| Tissue specificity | All four isoforms are widely distributed in brain. Isoforms alpha-1 and alpha-2 are predominantly expressed in hippocampus, cerebral cortex, caudate-putamen, amygdala and the granule layer of the cerebellum. Alpha-1 is more abundant than alpha-2 in the periaqueductal region and the substantia nigra. Ref.3 |
| Induction | In T-cells, following T-cell receptor (TCR) activation. Levels peak 48 hours after TCR and CD-28 costimulation. Ref.1 Ref.7 |
| Domain | The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases. |
| Post-translational modification | Dually phosphorylated on Thr-183 and Tyr-185 by MAP2K7 and MAP2K4, which activates the enzyme. Autophosphorylated in vitro By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Alpha-2 (identifier: Q9WTU6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Alpha-1 (identifier: Q9WTU6-2) The sequence of this isoform differs from the canonical sequence as follows: 377-423: DAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLEGCR → AQMQQ | ||||||
| Isoform Beta-1 (identifier: Q9WTU6-3) The sequence of this isoform differs from the canonical sequence as follows: 216-230: AEMVLHKVLFPGRDY → GELVKGCVIFQGTDH 377-423: DAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLEGCR → AQMQQ | ||||||
| Isoform Beta-2 (identifier: Q9WTU6-4) The sequence of this isoform differs from the canonical sequence as follows: 216-230: AEMVLHKVLFPGRDY → GELVKGCVIFQGTDH |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 423 | 423 | Mitogen-activated protein kinase 9 | PRO_0000186274 | |||||
Regions | |||||||||
| Domain | 26 – 321 | 296 | Protein kinase | ||||||
| Nucleotide binding | 33 – 38 | 6 | ATP By similarity | ||||||
| Motif | 183 – 185 | 3 | TXY | ||||||
Sites | |||||||||
| Active site | 151 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 55 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 183 | 1 | Phosphothreonine; by MAP2K7 Ref.11 | ||||||
| Modified residue | 185 | 1 | Phosphotyrosine; by MAP2K4 Ref.11 Ref.12 | ||||||
Natural variations | |||||||||
| Alternative sequence | 216 – 230 | 15 | AEMVL…PGRDY → GELVKGCVIFQGTDH in isoform Beta-1 and isoform Beta-2. | VSP_004836 | |||||
| Alternative sequence | 377 – 423 | 47 | DAAVS…LEGCR → AQMQQ in isoform Alpha-1 and isoform Beta-1. | VSP_004837 | |||||
Experimental info | |||||||||
| Sequence conflict | 223 | 1 | V → C Ref.3 | ||||||
| Sequence conflict | 237 | 1 | V → A in CAC88132. Ref.3 | ||||||
| Sequence conflict | 386 | 1 | P → A in BAC27623. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Differentiation of CD4+ T cells to Th1 cells requires MAP kinase JNK2." Yang D.D., Conze D., Whitmarsh A.J., Barrett T., Davis R.J., Rincon M., Flavell R.A. Immunity 9:575-585(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-1; ALPHA-2; BETA-1 AND BETA-2), FUNCTION, INDUCTION. |
| [2] | "JSAP1, a novel jun N-terminal protein kinase (JNK)-binding protein that functions as a scaffold factor in the JNK signaling pathway." Ito M., Yoshioka K., Akechi M., Yamashita S., Takamatsu N., Sugiyama K., Hibi M., Nakabeppu Y., Shiba T., Yamamoto K. Mol. Cell. Biol. 19:7539-7548(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA-1). Tissue: Brain. |
| [3] | "Analysis of splicing of four mouse JNK/SAPKalpha variants." Casanova E., Callejo A.I., Calvo P., Chinchetru M.A. NeuroReport 11:305-309(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS ALPHA-1; ALPHA-2; BETA-1 AND BETA-2), TISSUE SPECIFICITY. Tissue: Liver. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BETA-2). Strain: C57BL/6J. Tissue: Medulla oblongata. |
| [5] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BETA-2). Strain: FVB/N. Tissue: Salivary gland. |
| [7] | "JNK is required for effector T-cell function but not for T-cell activation." Dong C., Yang D.D., Tournier C., Whitmarsh A.J., Xu J., Davis R.J., Flavell R.A. Nature 405:91-94(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, ENZYME REGULATION, INDUCTION. Tissue: Embryonic stem cell and T-cell. |
| [8] | "Requirement of the JIP1 scaffold protein for stress-induced JNK activation." Whitmarsh A.J., Kuan C.-Y., Kennedy N.J., Kelkar N., Haydar T.F., Mordes J.P., Appel M., Rossini A.A., Jones S.N., Flavell R.A., Rakic P., Davis R.J. Genes Dev. 15:2421-2432(2001) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT. Tissue: Hippocampus. |
| [9] | "Common and divergent roles for members of the mouse DCX superfamily." Coquelle F.M., Levy T., Bergmann S., Wolf S.G., Bar-El D., Sapir T., Brody Y., Orr I., Barkai N., Eichele G., Reiner O. Cell Cycle 5:976-983(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DCLK2. |
| [10] | "JNK2 is a positive regulator of the cJun transcription factor." Jaeschke A., Karasarides M., Ventura J.J., Ehrhardt A., Zhang C., Flavell R.A., Shokat K.M., Davis R.J. Mol. Cell 23:899-911(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [11] | "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain." Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P. J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-183 AND TYR-185, MASS SPECTROMETRY. Tissue: Brain. |
| [12] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-185, MASS SPECTROMETRY. Tissue: Liver. |
| [13] | "Activity of all JNK isoforms contributes to neurite growth in spiral ganglion neurons." Atkinson P.J., Cho C.H., Hansen M.R., Green S.H. Hear. Res. 278:77-85(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN NEURITE GROWTH. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF052466 mRNA. Translation: AAD22576.1. AF052467 mRNA. Translation: AAD22577.1. AF052468 mRNA. Translation: AAD22578.1. AF052469 mRNA. Translation: AAD22579.1. AB005664 mRNA. Translation: BAA85876.1. AJ315339 AJ315350 Genomic DNA. Translation: CAC88132.1. Sequence problems.AK031959 mRNA. Translation: BAC27623.1. AL606479 Genomic DNA. Translation: CAI23940.1. AL606479 Genomic DNA. Translation: CAI23941.1. BC028341 mRNA. Translation: AAH28341.1. |
| IPI | IPI00123875. IPI00223339. IPI00223340. IPI00223342. |
| RefSeq | NP_001157143.1. NM_001163671.1. NP_001157144.1. NM_001163672.1. NP_058657.1. NM_016961.3. NP_997575.2. NM_207692.2. |
| UniGene | Mm.68933. |
3D structure databases | |
| ProteinModelPortal | Q9WTU6. |
| SMR | Q9WTU6. Positions 7-363. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9WTU6. 4 interactions. |
| MINT | MINT-1487632. |
PTM databases | |
| PhosphoSite | Q9WTU6. |
Proteomic databases | |
| PaxDb | Q9WTU6. |
| PRIDE | Q9WTU6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000020634; ENSMUSP00000020634; ENSMUSG00000020366. ENSMUST00000043321; ENSMUSP00000042744; ENSMUSG00000020366. ENSMUST00000102778; ENSMUSP00000099839; ENSMUSG00000020366. ENSMUST00000109178; ENSMUSP00000104807; ENSMUSG00000020366. ENSMUST00000109179; ENSMUSP00000104808; ENSMUSG00000020366. ENSMUST00000164643; ENSMUSP00000132864; ENSMUSG00000020366. ENSMUST00000178543; ENSMUSP00000136977; ENSMUSG00000020366. |
| GeneID | 26420. |
| KEGG | mmu:26420. |
| UCSC | uc007ird.2. mouse. |
Organism-specific databases | |
| CTD | 5601. |
| MGI | MGI:1346862. Mapk9. |
Phylogenomic databases | |
| eggNOG | COG0515. |
| GeneTree | ENSGT00550000074271. |
| HOVERGEN | HBG014652. |
| KO | K04440. |
| OMA | DWEERNK. |
| OrthoDB | EOG48SGT3. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.24. 3474. |
Gene expression databases | |
| ArrayExpress | Q9WTU6. |
| Bgee | Q9WTU6. |
| CleanEx | MM_MAPK9. |
| Genevestigator | Q9WTU6. |
| GermOnline | ENSMUSG00000020366. Mus musculus. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR003527. MAP_kinase_CS. IPR008351. MAPK_JNK. IPR000719. Prot_kinase_cat_dom. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| PRINTS | PR01772. JNKMAPKINASE. |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS01351. MAPK. 1 hit. PS00107. PROTEIN_KINASE_ATP. False negative. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 304437. |
| SOURCE | Search... |
Entry information
| Entry name | MK09_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9WTU6 Secondary accession number(s): Q5NCK9 Q9WTU5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
