SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9WTI7

- MYO1C_MOUSE

UniProt

Q9WTI7 - MYO1C_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Unconventional myosin-Ic
Gene
Myo1c
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails bind to membranous compartments, which then are moved relative to actin filaments. Involved in glucose transporter recycling in response to insulin by regulating movement of intracellular GLUT4-containing vesicles to the plasma membrane. Component of the hair cell's (the sensory cells of the inner ear) adaptation-motor complex. Acts as a mediator of adaptation of mechanoelectrical transduction in stereocilia of vestibular hair cells. Binds phosphoinositides and links the actin cytoskeleton to cellular membranes.9 Publications
Isoform 3 is involved in regulation of transcription. Associated with transcriptional active ribosomal genes. Appears to cooperate with the WICH chromatin-remodeling complex to facilitate transcription. Necessary for the formation of the first phosphodiester bond during transcription initiation.9 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei88 – 881ATP By similarity
Binding sitei96 – 961ATP By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi139 – 14810ATP By similarity
Nucleotide bindingi192 – 1965ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB
  2. actin binding Source: UniProtKB
  3. calmodulin binding Source: UniProtKB
  4. motor activity Source: InterPro
  5. phospholipid binding Source: UniProtKB
  6. protein C-terminus binding Source: UniProtKB
  7. protein binding Source: IntAct
Complete GO annotation...

GO - Biological processi

  1. mRNA transport Source: UniProtKB-KW
  2. positive regulation of cell migration by vascular endothelial growth factor signaling pathway Source: Ensembl
  3. positive regulation of protein targeting to membrane Source: Ensembl
  4. positive regulation of vascular endothelial growth factor signaling pathway Source: Ensembl
  5. protein targeting to membrane Source: Ensembl
  6. regulation of tight junction assembly Source: Ensembl
  7. transport Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Motor protein, Myosin

Keywords - Biological processi

mRNA transport, Protein transport, Translocation, Transport

Keywords - Ligandi

Actin-binding, ATP-binding, Calmodulin-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_198374. Regulation of actin dynamics for phagocytic cup formation.
REACT_199054. Translocation of GLUT4 to the plasma membrane.

Names & Taxonomyi

Protein namesi
Recommended name:
Unconventional myosin-Ic
Alternative name(s):
Myosin I beta
Short name:
MMI-beta
Short name:
MMIb
Gene namesi
Name:Myo1c
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:106612. Myo1c.

Subcellular locationi

Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell projectionstereocilium membrane. Cytoplasmic vesicle. Cell projectionruffle
Note: Colocalizes with CABP1 and CIB1 at cell margin, membrane ruffles and punctate regions on the cell membrane. Colocalizes in adipocytes with GLUT4 at actin-based membranes. Colocalizes with GLUT4 at insulin-induced ruffles at the cell membrane. Localizes transiently at cell membrane to region known to be enriched in PIP2. Activation of phospholipase C results in its redistribution to the cytoplasm.7 Publications
Isoform 3 : Nucleusnucleolus. Nucleusnucleoplasm By similarity. Nucleusnuclear pore complex By similarity
Note: In the nucleolus, is localized predominantly in dense fibrillar component (DFC) and in granular component (GC). Accumulates strongly in DFC and GC during activation of transcription. Colocalizes with transcription sites. Colocalizes in the granular cortex at the periphery of the nucleolus with RPS6. Colocalizes in nucleoplasm with RPS6 and actin that are in contact with RNP particles. Colocalizes with RPS6 at the nuclear pore level By similarity. Colocalizes with RNA polymerase II in the nucleus. Colocalizes with RNA polymerase I in nucleoli.7 Publications

GO - Cellular componenti

  1. basal plasma membrane Source: Ensembl
  2. brush border Source: MGI
  3. cytoplasmic membrane-bounded vesicle Source: UniProtKB-SubCell
  4. cytosol Source: Reactome
  5. extracellular vesicular exosome Source: Ensembl
  6. filamentous actin Source: Ensembl
  7. lateral plasma membrane Source: Ensembl
  8. membrane Source: UniProtKB
  9. membrane raft Source: Ensembl
  10. myosin I complex Source: MGI
  11. nuclear pore Source: UniProtKB-SubCell
  12. nucleolus Source: UniProtKB-SubCell
  13. nucleoplasm Source: UniProtKB-SubCell
  14. ruffle Source: UniProtKB-SubCell
  15. stereocilium Source: MGI
  16. stereocilium membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoplasmic vesicle, Membrane, Nuclear pore complex, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi927 – 9271K → A: Inhibits binding to PIP2 and disrupts membrane binding. 1 Publication
Mutagenesisi938 – 9381R → A: Inhibits binding to PIP2 and disrupts membrane binding. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10631063Unconventional myosin-Ic
PRO_0000123446Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei383 – 3831N6-methyllysine By similarity
Modified residuei408 – 4081Phosphoserine By similarity
Modified residuei486 – 4861N6-acetyllysine1 Publication

Post-translational modificationi

Isoform 2 contains a N-acetylmethionine at position 1 By similarity.

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

MaxQBiQ9WTI7.
PaxDbiQ9WTI7.
PRIDEiQ9WTI7.

PTM databases

PhosphoSiteiQ9WTI7.

Expressioni

Tissue specificityi

Isoform 3 is expressed in small intestine, pancreas, brain, kidney, skin, heart muscle, testis, striated muscle, spleen, liver and lung (at protein level). Expressed in brain, testis, adrenal glands, thymus, spleen, kidney, lung, heart, cochlea and vestibule. Expressed in sensory hair cells of the inner ear. Expressed in adipocytes.4 Publications

Inductioni

Up-regulated by serum.1 Publication

Gene expression databases

ArrayExpressiQ9WTI7.
BgeeiQ9WTI7.
CleanExiMM_MYO1C.
GenevestigatoriQ9WTI7.

Interactioni

Subunit structurei

Interacts (via its IQ motifs) with CALM; this precludes interaction with YWHAB. Interacts with YWHAB; this precludes interaction with CALM. Interacts with RPS6 By similarity. Interacts with actin filaments. Interacts (via its IQ motifs) with CABP1 and CIB1; the interaction with CABP1 and CIB1 is calcium-dependent. Interacts (via tail domain) with PLEKHB1 (via PH domain); the interaction is not affected by the presence or absence of calcium and CALM. Interacts with POLR1A and POLR2A. Component of the B-WICH complex, at least composed of SMARCA5/SNF2H, BAZ1B/WSTF, SF3B1, DEK, MYO1C, ERCC6, MYBBP1A and DDX21. Interacts with GLUT4.6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Plekhb1Q9QYE9-14EBI-777558,EBI-1127141
Plekhb1Q9QYE9-22EBI-777558,EBI-1127145

Protein-protein interaction databases

BioGridi201664. 4 interactions.
IntActiQ9WTI7. 9 interactions.
MINTiMINT-4129061.

Structurei

3D structure databases

ProteinModelPortaliQ9WTI7.
SMRiQ9WTI7. Positions 44-755, 772-801.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini47 – 731685Myosin motor
Add
BLAST
Domaini734 – 75724IQ 1
Add
BLAST
Domaini758 – 78629IQ 2
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni927 – 93812PIP2-binding motif
Add
BLAST

Domaini

Binds directly to large unilamellar vesicles (LUVs) containing phosphatidylinositol 4,5-bisphosphate (PIP2) or inositol 1,4,5-trisphosphate (InsP3). The PIP2-binding site corresponds to a putative PH domain present in its tail domain.

Sequence similaritiesi

Contains 2 IQ domains.

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiCOG5022.
GeneTreeiENSGT00750000117217.
HOVERGENiHBG062373.
InParanoidiQ3U231.
KOiK10356.
OMAiYAETCPA.
OrthoDBiEOG7V49XQ.
PhylomeDBiQ9WTI7.
TreeFamiTF312960.

Family and domain databases

InterProiIPR000048. IQ_motif_EF-hand-BS.
IPR001609. Myosin_head_motor_dom.
IPR010926. Myosin_tail_2.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00612. IQ. 2 hits.
PF00063. Myosin_head. 1 hit.
PF06017. Myosin_TH1. 1 hit.
[Graphical view]
PRINTSiPR00193. MYOSINHEAVY.
SMARTiSM00015. IQ. 2 hits.
SM00242. MYSc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS50096. IQ. 2 hits.
PS51456. MYOSIN_MOTOR. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9WTI7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MALQVELIPT GEIIRVVHPH RPCKLALGSD GVRVTMESAL TARDRVGVQD     50
FVLLENFTSE AAFIENLRRR FRENLIYTYI GPVLVSVNPY RDLQIYSRQH 100
MERYRGVSFY EVPPHLFAVA DTVYRALRTE RRDQAVMISG ESGAGKTEAT 150
KRLLQFYAET CPAPERGGAV RDRLLQSNPV LEAFGNAKTL RNDNSSRFGK 200
YMDVQFDFKG APVGGHILSY LLEKSRVVHQ NHGERNFHVF YQLLEGGEEE 250
TLRRLGLERN PQSYLYLVKG QCAKVSSIND KSDWKVMRKA LSVIDFTEDE 300
VEDLLSIVAS VLHLGNIHFA ADEDSNAQVT TENQLKYLTR LLGVEGTTLR 350
EALTHRKIIA KGEELLSPLN LEQAAYARDA LAKAVYSRTF TWLVRKINRS 400
LASKDAESPS WRSTTVLGLL DIYGFEVFQH NSFEQFCINY CNEKLQQLFI 450
ELTLKSEQEE YEAEGIAWEP VQYFNNKIIC DLVEEKFKGI ISILDEECLR 500
PGEATDLTFL EKLEDTVKPH PHFLTHKLAD QKTRKSLDRG EFRLLHYAGE 550
VTYSVTGFLD KNNDLLFRNL KETMCSSMNP IMAQCFDKSE LSDKKRPETV 600
ATQFKMSLLQ LVEILRSKEP AYIRCIKPND AKQPGRFDEV LIRHQVKYLG 650
LMENLRVRRA GFAYRRKYEA FLQRYKSLCP ETWPMWAGRP QDGVAVLVRH 700
LGYKPEEYKM GRTKIFIRFP KTLFATEDSL EVRRQSLATK IQAAWRGFHW 750
RQKFLRVKRS AICIQSWWRG TLGRRKAAKR KWAAQTIRRL IRGFILRHSP 800
RCPENAFFLD HVRASFLLNL RRQLPRNVLD TSWPTPPPAL REASELLREL 850
CMKNMVWKYC RSISPEWKQQ LQQKAVASEI FKGKKDNYPQ SVPRLFISTR 900
LGTEEISPRV LQSLGSEPIQ YAVPVVKYDR KGYKPRPRQL LLTPSAVVIV 950
EDAKVKQRID YANLTGISVS SLSDSLFVLH VQREDNKQKG DVVLQSDHVI 1000
ETLTKTALSA DRVNNININQ GSITFAGGPG RDGIIDFTSG SELLITKAKN 1050
GHLAVVAPRL NSR 1063

Note: Gene prediction based on EST data.

Length:1,063
Mass (Da):121,944
Last modified:April 14, 2009 - v2
Checksum:i494A31B8634A1AF9
GO
Isoform 2 (identifier: Q9WTI7-2) [UniParc]FASTAAdd to Basket

Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: Missing.

Note: Contains a N-acetylmethionine at position 1 (By similarity).

Show »
Length:1,028
Mass (Da):118,156
Checksum:i2CF5535D816884DF
GO
Isoform 3 (identifier: Q9WTI7-3) [UniParc]FASTAAdd to Basket

Also known as: Nuclear myosin 1, NM1

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MALQVELIPTGEIIRVVHPHRPCKL → MRYRAS

Show »
Length:1,044
Mass (Da):119,877
Checksum:iCDAB0FF699D041C9
GO
Isoform 4 (identifier: Q9WTI7-4) [UniParc]FASTAAdd to Basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     932-1063: GYKPRPRQLL...AVVAPRLNSR → VTSLAPGSCCSRPVLWSLWRMLKSSRELIMPT

Note: No experimental confirmation available. May be due to a frameshift.

Show »
Length:963
Mass (Da):111,290
Checksum:iC8CEFAE7FADE5B41
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3535Missing in isoform 2.
VSP_036863Add
BLAST
Alternative sequencei1 – 2525MALQV…RPCKL → MRYRAS in isoform 3.
VSP_036864Add
BLAST
Alternative sequencei932 – 1063132GYKPR…RLNSR → VTSLAPGSCCSRPVLWSLWR MLKSSRELIMPT in isoform 4.
VSP_003350Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti69 – 702RR → GG in CAA67956. 1 Publication
Sequence conflicti97 – 993SRQ → RRK in CAA67956. 1 Publication
Sequence conflicti102 – 1021E → G in BAE33311. 1 Publication
Sequence conflicti107 – 1071V → I in BAE33311. 1 Publication
Sequence conflicti251 – 2511T → A1 Publication
Sequence conflicti272 – 2721C → F1 Publication
Sequence conflicti286 – 2872VM → LL1 Publication
Sequence conflicti388 – 3881R → A1 Publication
Sequence conflicti401 – 4033LAS → VPA1 Publication
Sequence conflicti446 – 4461Q → R1 Publication
Sequence conflicti517 – 5193VKP → IKH1 Publication
Sequence conflicti578 – 5781M → T1 Publication
Sequence conflicti607 – 6071S → G1 Publication
Sequence conflicti735 – 7351Q → R in CAA67956. 1 Publication
Sequence conflicti821 – 8211R → G in CAA67956. 1 Publication
Sequence conflicti842 – 8421E → D in CAA67956. 1 Publication
Sequence conflicti1024 – 10241T → A in BAE33311. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U96723 mRNA. Translation: AAC53264.1.
U96726 Genomic DNA. Translation: AAC60758.1.
AY007255 mRNA. Translation: AAG02570.1.
AK004743 mRNA. Translation: BAB23524.1.
AK154294 mRNA. Translation: BAE32495.1.
AK155530 mRNA. Translation: BAE33311.1.
AK171107 mRNA. Translation: BAE42253.1.
AL591440 Genomic DNA. Translation: CAI24085.1.
AL591440 Genomic DNA. Translation: CAI24086.2.
AL591440 Genomic DNA. Translation: CAI24088.2.
CH466596 Genomic DNA. Translation: EDL12832.1.
CH466596 Genomic DNA. Translation: EDL12833.1.
BC021481 mRNA. Translation: AAH21481.1.
X99638 mRNA. Translation: CAA67956.1.
CF615767 mRNA. No translation available.
CCDSiCCDS25054.1. [Q9WTI7-2]
CCDS36228.1. [Q9WTI7-3]
PIRiB45438.
H75634.
RefSeqiNP_001074243.1. NM_001080774.1. [Q9WTI7-2]
NP_001074244.1. NM_001080775.1. [Q9WTI7-3]
NP_032685.1. NM_008659.3. [Q9WTI7-2]
XP_006532492.1. XM_006532429.1. [Q9WTI7-1]
UniGeneiMm.234502.

Genome annotation databases

EnsembliENSMUST00000069057; ENSMUSP00000070388; ENSMUSG00000017774. [Q9WTI7-2]
ENSMUST00000102504; ENSMUSP00000099562; ENSMUSG00000017774. [Q9WTI7-2]
ENSMUST00000102505; ENSMUSP00000099563; ENSMUSG00000017774. [Q9WTI7-1]
ENSMUST00000108431; ENSMUSP00000104069; ENSMUSG00000017774. [Q9WTI7-3]
GeneIDi17913.
KEGGimmu:17913.
UCSCiuc007kem.1. mouse. [Q9WTI7-1]
uc007keo.1. mouse. [Q9WTI7-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U96723 mRNA. Translation: AAC53264.1 .
U96726 Genomic DNA. Translation: AAC60758.1 .
AY007255 mRNA. Translation: AAG02570.1 .
AK004743 mRNA. Translation: BAB23524.1 .
AK154294 mRNA. Translation: BAE32495.1 .
AK155530 mRNA. Translation: BAE33311.1 .
AK171107 mRNA. Translation: BAE42253.1 .
AL591440 Genomic DNA. Translation: CAI24085.1 .
AL591440 Genomic DNA. Translation: CAI24086.2 .
AL591440 Genomic DNA. Translation: CAI24088.2 .
CH466596 Genomic DNA. Translation: EDL12832.1 .
CH466596 Genomic DNA. Translation: EDL12833.1 .
BC021481 mRNA. Translation: AAH21481.1 .
X99638 mRNA. Translation: CAA67956.1 .
CF615767 mRNA. No translation available.
CCDSi CCDS25054.1. [Q9WTI7-2 ]
CCDS36228.1. [Q9WTI7-3 ]
PIRi B45438.
H75634.
RefSeqi NP_001074243.1. NM_001080774.1. [Q9WTI7-2 ]
NP_001074244.1. NM_001080775.1. [Q9WTI7-3 ]
NP_032685.1. NM_008659.3. [Q9WTI7-2 ]
XP_006532492.1. XM_006532429.1. [Q9WTI7-1 ]
UniGenei Mm.234502.

3D structure databases

ProteinModelPortali Q9WTI7.
SMRi Q9WTI7. Positions 44-755, 772-801.
ModBasei Search...

Protein-protein interaction databases

BioGridi 201664. 4 interactions.
IntActi Q9WTI7. 9 interactions.
MINTi MINT-4129061.

PTM databases

PhosphoSitei Q9WTI7.

Proteomic databases

MaxQBi Q9WTI7.
PaxDbi Q9WTI7.
PRIDEi Q9WTI7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000069057 ; ENSMUSP00000070388 ; ENSMUSG00000017774 . [Q9WTI7-2 ]
ENSMUST00000102504 ; ENSMUSP00000099562 ; ENSMUSG00000017774 . [Q9WTI7-2 ]
ENSMUST00000102505 ; ENSMUSP00000099563 ; ENSMUSG00000017774 . [Q9WTI7-1 ]
ENSMUST00000108431 ; ENSMUSP00000104069 ; ENSMUSG00000017774 . [Q9WTI7-3 ]
GeneIDi 17913.
KEGGi mmu:17913.
UCSCi uc007kem.1. mouse. [Q9WTI7-1 ]
uc007keo.1. mouse. [Q9WTI7-3 ]

Organism-specific databases

CTDi 4641.
MGIi MGI:106612. Myo1c.

Phylogenomic databases

eggNOGi COG5022.
GeneTreei ENSGT00750000117217.
HOVERGENi HBG062373.
InParanoidi Q3U231.
KOi K10356.
OMAi YAETCPA.
OrthoDBi EOG7V49XQ.
PhylomeDBi Q9WTI7.
TreeFami TF312960.

Enzyme and pathway databases

Reactomei REACT_198374. Regulation of actin dynamics for phagocytic cup formation.
REACT_199054. Translocation of GLUT4 to the plasma membrane.

Miscellaneous databases

ChiTaRSi MYO1C. mouse.
NextBioi 292757.
PROi Q9WTI7.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9WTI7.
Bgeei Q9WTI7.
CleanExi MM_MYO1C.
Genevestigatori Q9WTI7.

Family and domain databases

InterProi IPR000048. IQ_motif_EF-hand-BS.
IPR001609. Myosin_head_motor_dom.
IPR010926. Myosin_tail_2.
IPR027417. P-loop_NTPase.
[Graphical view ]
Pfami PF00612. IQ. 2 hits.
PF00063. Myosin_head. 1 hit.
PF06017. Myosin_TH1. 1 hit.
[Graphical view ]
PRINTSi PR00193. MYOSINHEAVY.
SMARTi SM00015. IQ. 2 hits.
SM00242. MYSc. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 1 hit.
PROSITEi PS50096. IQ. 2 hits.
PS51456. MYOSIN_MOTOR. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The vibrator mutation causes neurodegeneration via reduced expression of PITP alpha: positional complementation cloning and extragenic suppression."
    Hamilton B.A., Smith D.J., Mueller K.L., Kerrebrock A.W., Bronson R.T., van Berkel V., Daly M.J., Kruglyak L., Reeve M.P., Nemhauser J.L., Hawkins T.L., Rubin E.M., Lander E.S.
    Neuron 18:711-722(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 2 AND 4).
    Strain: DBA/2J.
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INTERACTION WITH POLR2A, SUBCELLULAR LOCATION.
    Tissue: Embryo.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: C57BL/6J and NOD.
    Tissue: Lung.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  5. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUN-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: FVB/N.
    Tissue: Mammary gland.
  7. "Cloning of the genes encoding two murine and human cochlear unconventional type I myosins."
    Crozet F., El-Amraoui A., Blanchard S., Lenoir M., Ripoll C., Vago P., Hamel C., Fizames C., Levi-Acobas F., Depetris D., Mattei M.-G., Weil D., Pujol R., Petit C.
    Genomics 40:332-341(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-842 (ISOFORM 2), TISSUE SPECIFICITY.
    Strain: BALB/c.
    Tissue: Cochlea.
  8. Gerhard D.S.
    Submitted (SEP-2008) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-34 (ISOFORM 1).
    Tissue: Placenta.
  9. "Mammalian myosin I alpha, I beta, and I gamma: new widely expressed genes of the myosin I family."
    Sherr E.H., Joyce M.P., Greene L.A.
    J. Cell Biol. 120:1405-1416(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 181-628 (ISOFORM 1/2/3/4).
  10. "A chemical-genetic strategy implicates myosin-1c in adaptation by hair cells."
    Holt J.R., Gillespie S.K., Provance D.W., Shah K., Shokat K.M., Corey D.P., Mercer J.A., Gillespie P.G.
    Cell 108:371-381(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  11. "Glucose transporter recycling in response to insulin is facilitated by myosin Myo1c."
    Bose A., Guilherme A., Robida S.I., Nicoloro S.M., Zhou Q.L., Jiang Z.Y., Pomerleau D.P., Czech M.P.
    Nature 420:821-824(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  12. Cited for: FUNCTION.
  13. "An actin-myosin complex on actively transcribing genes."
    Fomproix N., Percipalle P.
    Exp. Cell Res. 294:140-148(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  14. "PHR1, an integral membrane protein of the inner ear sensory cells, directly interacts with myosin 1c and myosin VIIa."
    Etournay R., El-Amraoui A., Bahloul A., Blanchard S., Roux I., Pezeron G., Michalski N., Daviet L., Hardelin J.-P., Legrain P., Petit C.
    J. Cell Sci. 118:2891-2899(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PLEKHB1.
  15. "Fast adaptation in vestibular hair cells requires myosin-1c activity."
    Stauffer E.A., Scarborough J.D., Hirono M., Miller E.D., Shah K., Mercer J.A., Holt J.R., Gillespie P.G.
    Neuron 47:541-553(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  16. "The chromatin remodelling complex WSTF-SNF2h interacts with nuclear myosin 1 and has a role in RNA polymerase I transcription."
    Percipalle P., Fomproix N., Cavellan E., Voit R., Reimer G., Krueger T., Thyberg J., Scheer U., Grummt I., Oestlund Farrants A.-K.O.
    EMBO Rep. 7:525-530(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH BAZ1B, POLR1A AND SMARCA5, SUBCELLULAR LOCATION.
  17. "Nuclear myosin I is necessary for the formation of the first phosphodiester bond during transcription initiation by RNA polymerase II."
    Hofmann W.A., Vargas G.M., Ramchandran R., Stojiljkovic L., Goodrich J.A., de Lanerolle P.
    J. Cell. Biochem. 99:1001-1009(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH POLR2A.
  18. "Myo1c binds phosphoinositides through a putative pleckstrin homology domain."
    Hokanson D.E., Laakso J.M., Lin T., Sept D., Ostap E.M.
    Mol. Biol. Cell 17:4856-4865(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF LYS-927 AND ARG-938.
  19. "Myo1c binds tightly and specifically to phosphatidylinositol 4,5-bisphosphate and inositol 1,4,5-trisphosphate."
    Hokanson D.E., Ostap E.M.
    Proc. Natl. Acad. Sci. U.S.A. 103:3118-3123(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  20. "Nuclear myosin is ubiquitously expressed and evolutionary conserved in vertebrates."
    Kahle M., Pridalova J., Spacek M., Dzijak R., Hozak P.
    Histochem. Cell Biol. 127:139-148(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  21. Cited for: INTERACTION WITH CABP1 AND CIB1, SUBCELLULAR LOCATION.
  22. "Myo1c binding to submembrane actin mediates insulin-induced tethering of GLUT4 vesicles."
    Boguslavsky S., Chiu T., Foley K.P., Osorio-Fuentealba C., Antonescu C.N., Bayer K.U., Bilan P.J., Klip A.
    Mol. Biol. Cell 23:4065-4078(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH GLUT4, ACTIN-BINDING.
  23. "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways."
    Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.
    Mol. Cell 50:919-930(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-486, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.

Entry informationi

Entry nameiMYO1C_MOUSE
AccessioniPrimary (citable) accession number: Q9WTI7
Secondary accession number(s): O08571
, O08834, Q3TBQ4, Q3U231, Q5ND46, Q5ND48, Q5ND49, Q9ERB6, Q9QW54
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: April 14, 2009
Last modified: September 3, 2014
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi