Q9WTI7 (MYO1C_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Unconventional myosin-Ic Alternative name(s): Myosin I beta Short name=MMI-beta Short name=MMIb | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1063 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments By similarity. Involved in glucose transporter recycling in response to insulin by regulating movement of intracellular GLUT4-containing vesicles to the plasma membrane. Component of the hair cell's (the sensory cells of the inner ear) adaptation-motor complex. Acts as a mediator of adaptation of mechanoelectrical transduction in stereocilia of vestibular hair cells. Binds phosphoinositides and links the actin cytoskeleton to cellular membranes. Ref.10 Ref.11 Ref.12 Ref.13 Ref.15 Ref.17 Ref.18 Ref.19 Isoform 3 is involved in regulation of transcription. Associated with transcriptional active ribosomal genes. Appears to cooperate with the WICH chromatin-remodeling complex to facilitate transcription. Necessary for the formation of the first phosphodiester bond during transcription initiation. Ref.10 Ref.11 Ref.12 Ref.13 Ref.15 Ref.17 Ref.18 Ref.19 |
| Subunit structure | Interacts (via its IQ motifs) with calmodulin. Interacts with RPS6 and actin By similarity. Interacts (via its IQ motifs) with CABP1 and CIB1; the interaction with CABP1 and CIB1 is calcium-dependent. Interacts (via tail domain) with PLEKHB1 (via PH domain); the interaction is not affected by the presence or absence of calcium and calmodulin. Interacts with POLR1A and POLR2A. Component of the B-WICH complex, at least composed of SMARCA5/SNF2H, BAZ1B/WSTF, SF3B1, DEK, MYO1C, ERCC6, MYBBP1A and DDX21. Ref.2 Ref.14 Ref.16 Ref.17 Ref.21 |
| Subcellular location | Cytoplasm. Cell membrane. Cell projection › stereocilium membrane. Note: Colocalizes with CABP1 and CIB1 at cell margin, membrane ruffles and punctate regions on the cell membrane. Colocalizes in adipocytes with GLUT4 in actin-based membranes. Localizes transiently at cell membrane to region known to be enriched in PIP2. Activation of phospholipase C results in its redistribution to the cytoplasm. Ref.2 Ref.11 Ref.16 Ref.19 Ref.20 Ref.21 Isoform 3: Nucleus › nucleolus. Nucleus › nucleoplasm By similarity. Nucleus › nuclear pore complex By similarity. Note: In the nucleolus, is localized predominantly in dense fibrillar component (DFC) and in granular component (GC). Accumulates strongly in DFC and GC during activation of transcription. Colocalizes with transcription sites. Colocalizes in the granular cortex at the periphery of the nucleolus with RPS6. Colocalizes in nucleoplasm with RPS6 and actin that are in contact with RNP particles. Colocalizes with RPS6 at the nuclear pore level By similarity. Colocalizes with RNA polymerase II in the nucleus. Colocalizes with RNA polymerase I in nucleoli. Ref.2 Ref.11 Ref.16 Ref.19 Ref.20 Ref.21 |
| Tissue specificity | Isoform 3 is expressed in small intestine, pancreas, brain, kidney, skin, heart muscle, testis, striated muscle, spleen, liver and lung (at protein level). Expressed in brain, testis, adrenal glands, thymus, spleen, kidney, lung, heart, cochlea and vestibule. Expressed in sensory hair cells of the inner ear. Expressed in adipocytes. Ref.7 Ref.11 Ref.15 Ref.20 |
| Induction | Up-regulated by serum. Ref.20 |
| Domain | Binds directly to large unilamellar vesicles (LUVs) containing phosphatidylinositol 4,5-bisphosphate (PIP2) or inositol 1,4,5-trisphosphate (InsP3). The PIP2-binding site corresponds to a putative PH domain present in its tail domain. |
| Post-translational modification | Isoform 2 contains a N-acetylmethionine at position 1 By similarity. |
| Sequence similarities | Contains 2 IQ domains. Contains 1 myosin head-like domain. |
| Caution | Represents a unconventional myosin. This protein should not be confused with the conventional myosin-1 (MYH1). |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Plekhb1 | Q9QYE9-1 | 4 | EBI-777558,EBI-1127141 | |
| Plekhb1 | Q9QYE9-2 | 2 | EBI-777558,EBI-1127145 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9WTI7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Gene prediction based on EST data. | ||||||
| Isoform 2 (identifier: Q9WTI7-2) Also known as: A; The sequence of this isoform differs from the canonical sequence as follows: 1-35: Missing. | ||||||
| Note: Contains a N-acetylmethionine at position 1 (By similarity). | ||||||
| Isoform 3 (identifier: Q9WTI7-3) Also known as: Nuclear myosin 1; NM1; The sequence of this isoform differs from the canonical sequence as follows: 1-25: MALQVELIPTGEIIRVVHPHRPCKL → MRYRAS | ||||||
| Isoform 4 (identifier: Q9WTI7-4) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 932-1063: GYKPRPRQLL...AVVAPRLNSR → VTSLAPGSCCSRPVLWSLWRMLKSSRELIMPT | ||||||
| Note: No experimental confirmation available. May be due to a frameshift. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1063 | 1063 | Unconventional myosin-Ic | PRO_0000123446 | |||||
Regions | |||||||||
| Domain | 36 – 718 | 683 | Myosin head-like | ||||||
| Domain | 734 – 757 | 24 | IQ 1 | ||||||
| Domain | 758 – 786 | 29 | IQ 2 | ||||||
| Nucleotide binding | 140 – 147 | 8 | ATP Potential | ||||||
| Region | 927 – 938 | 12 | PIP2-binding motif | ||||||
Amino acid modifications | |||||||||
| Modified residue | 383 | 1 | N6-methyllysine By similarity | ||||||
| Modified residue | 408 | 1 | Phosphoserine Ref.22 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 35 | 35 | Missing in isoform 2. | VSP_036863 | |||||
| Alternative sequence | 1 – 25 | 25 | MALQV…RPCKL → MRYRAS in isoform 3. | VSP_036864 | |||||
| Alternative sequence | 932 – 1063 | 132 | GYKPR…RLNSR → VTSLAPGSCCSRPVLWSLWR MLKSSRELIMPT in isoform 4. | VSP_003350 | |||||
Experimental info | |||||||||
| Mutagenesis | 927 | 1 | K → A: Inhibits binding to PIP2 and disrupts membrane binding. Ref.18 | ||||||
| Mutagenesis | 938 | 1 | R → A: Inhibits binding to PIP2 and disrupts membrane binding. Ref.18 | ||||||
| Sequence conflict | 69 – 70 | 2 | RR → GG in CAA67956. Ref.7 | ||||||
| Sequence conflict | 97 – 99 | 3 | SRQ → RRK in CAA67956. Ref.7 | ||||||
| Sequence conflict | 102 | 1 | E → G in BAE33311. Ref.3 | ||||||
| Sequence conflict | 107 | 1 | V → I in BAE33311. Ref.3 | ||||||
| Sequence conflict | 251 | 1 | T → A Ref.9 | ||||||
| Sequence conflict | 272 | 1 | C → F Ref.9 | ||||||
| Sequence conflict | 286 – 287 | 2 | VM → LL Ref.9 | ||||||
| Sequence conflict | 388 | 1 | R → A Ref.9 | ||||||
| Sequence conflict | 401 – 403 | 3 | LAS → VPA Ref.9 | ||||||
| Sequence conflict | 446 | 1 | Q → R Ref.9 | ||||||
| Sequence conflict | 517 – 519 | 3 | VKP → IKH Ref.9 | ||||||
| Sequence conflict | 578 | 1 | M → T Ref.9 | ||||||
| Sequence conflict | 607 | 1 | S → G Ref.9 | ||||||
| Sequence conflict | 735 | 1 | Q → R in CAA67956. Ref.7 | ||||||
| Sequence conflict | 821 | 1 | R → G in CAA67956. Ref.7 | ||||||
| Sequence conflict | 842 | 1 | E → D in CAA67956. Ref.7 | ||||||
| Sequence conflict | 1024 | 1 | T → A in BAE33311. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The vibrator mutation causes neurodegeneration via reduced expression of PITP alpha: positional complementation cloning and extragenic suppression." Hamilton B.A., Smith D.J., Mueller K.L., Kerrebrock A.W., Bronson R.T., van Berkel V., Daly M.J., Kruglyak L., Reeve M.P., Nemhauser J.L., Hawkins T.L., Rubin E.M., Lander E.S. Neuron 18:711-722(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 2 AND 4). Strain: DBA/2J. Tissue: Brain. |
| [2] | "A myosin I isoform in the nucleus." Pestic-Dragovich L., Stojiljkovic L., Philimonenko A.A., Nowak G., Ke Y., Settlage R.E., Shabanowitz J., Hunt D.F., Hozak P., de Lanerolle P. Science 290:337-341(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INTERACTION WITH POLR2A, SUBCELLULAR LOCATION. Tissue: Embryo. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Strain: C57BL/6J and NOD. Tissue: Lung. |
| [4] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [5] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (JUN-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: FVB/N. Tissue: Mammary gland. |
| [7] | "Cloning of the genes encoding two murine and human cochlear unconventional type I myosins." Crozet F., El-Amraoui A., Blanchard S., Lenoir M., Ripoll C., Vago P., Hamel C., Fizames C., Levi-Acobas F., Depetris D., Mattei M.-G., Weil D., Pujol R., Petit C. Genomics 40:332-341(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-842 (ISOFORM 2), TISSUE SPECIFICITY. Strain: BALB/c. Tissue: Cochlea. |
| [8] | Gerhard D.S. Submitted (SEP-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-34 (ISOFORM 1). Tissue: Placenta. |
| [9] | "Mammalian myosin I alpha, I beta, and I gamma: new widely expressed genes of the myosin I family." Sherr E.H., Joyce M.P., Greene L.A. J. Cell Biol. 120:1405-1416(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 181-628 (ISOFORM 1/2/3/4). |
| [10] | "A chemical-genetic strategy implicates myosin-1c in adaptation by hair cells." Holt J.R., Gillespie S.K., Provance D.W., Shah K., Shokat K.M., Corey D.P., Mercer J.A., Gillespie P.G. Cell 108:371-381(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [11] | "Glucose transporter recycling in response to insulin is facilitated by myosin Myo1c." Bose A., Guilherme A., Robida S.I., Nicoloro S.M., Zhou Q.L., Jiang Z.Y., Pomerleau D.P., Czech M.P. Nature 420:821-824(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [12] | "Myo1c is designed for the adaptation response in the inner ear." Batters C., Arthur C.P., Lin A., Porter J., Geeves M.A., Milligan R.A., Molloy J.E., Coluccio L.M. EMBO J. 23:1433-1440(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [13] | "An actin-myosin complex on actively transcribing genes." Fomproix N., Percipalle P. Exp. Cell Res. 294:140-148(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [14] | "PHR1, an integral membrane protein of the inner ear sensory cells, directly interacts with myosin 1c and myosin VIIa." Etournay R., El-Amraoui A., Bahloul A., Blanchard S., Roux I., Pezeron G., Michalski N., Daviet L., Hardelin J.-P., Legrain P., Petit C. J. Cell Sci. 118:2891-2899(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PLEKHB1. |
| [15] | "Fast adaptation in vestibular hair cells requires myosin-1c activity." Stauffer E.A., Scarborough J.D., Hirono M., Miller E.D., Shah K., Mercer J.A., Holt J.R., Gillespie P.G. Neuron 47:541-553(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [16] | "The chromatin remodelling complex WSTF-SNF2h interacts with nuclear myosin 1 and has a role in RNA polymerase I transcription." Percipalle P., Fomproix N., Cavellan E., Voit R., Reimer G., Krueger T., Thyberg J., Scheer U., Grummt I., Oestlund Farrants A.-K.O. EMBO Rep. 7:525-530(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH BAZ1B, POLR1A AND SMARCA5, SUBCELLULAR LOCATION. |
| [17] | "Nuclear myosin I is necessary for the formation of the first phosphodiester bond during transcription initiation by RNA polymerase II." Hofmann W.A., Vargas G.M., Ramchandran R., Stojiljkovic L., Goodrich J.A., de Lanerolle P. J. Cell. Biochem. 99:1001-1009(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH POLR2A. |
| [18] | "Myo1c binds phosphoinositides through a putative pleckstrin homology domain." Hokanson D.E., Laakso J.M., Lin T., Sept D., Ostap E.M. Mol. Biol. Cell 17:4856-4865(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF LYS-927 AND ARG-938. |
| [19] | "Myo1c binds tightly and specifically to phosphatidylinositol 4,5-bisphosphate and inositol 1,4,5-trisphosphate." Hokanson D.E., Ostap E.M. Proc. Natl. Acad. Sci. U.S.A. 103:3118-3123(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [20] | "Nuclear myosin is ubiquitously expressed and evolutionary conserved in vertebrates." Kahle M., Pridalova J., Spacek M., Dzijak R., Hozak P. Histochem. Cell Biol. 127:139-148(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [21] | "CIB1 and CaBP1 bind to the myo1c regulatory domain." Tang N., Lin T., Yang J., Foskett J.K., Ostap E.M. J. Muscle Res. Cell Motil. 28:285-291(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CABP1 AND CIB1, SUBCELLULAR LOCATION. |
| [22] | "The phagosomal proteome in interferon-gamma-activated macrophages." Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P. Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-408, MASS SPECTROMETRY. Tissue: Macrophage. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U96723 mRNA. Translation: AAC53264.1. U96726 Genomic DNA. Translation: AAC60758.1. AY007255 mRNA. Translation: AAG02570.1. AK004743 mRNA. Translation: BAB23524.1. AK154294 mRNA. Translation: BAE32495.1. AK155530 mRNA. Translation: BAE33311.1. AK171107 mRNA. Translation: BAE42253.1. AL591440 Genomic DNA. Translation: CAI24085.1. AL591440 Genomic DNA. Translation: CAI24086.2. AL591440 Genomic DNA. Translation: CAI24088.2. CH466596 Genomic DNA. Translation: EDL12832.1. CH466596 Genomic DNA. Translation: EDL12833.1. BC021481 mRNA. Translation: AAH21481.1. X99638 mRNA. Translation: CAA67956.1. CF615767 mRNA. No translation available. |
| IPI | IPI00467172. IPI00620222. IPI00754649. IPI00928288. |
| PIR | B45438. H75634. |
| RefSeq | NP_001074243.1. NM_001080774.1. NP_001074244.1. NM_001080775.1. NP_032685.1. NM_008659.3. |
| UniGene | Mm.234502. |
3D structure databases | |
| ProteinModelPortal | Q9WTI7. |
| SMR | Q9WTI7. Positions 47-732. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9WTI7. 5 interactions. |
PTM databases | |
| PhosphoSite | Q9WTI7. |
Proteomic databases | |
| PaxDb | Q9WTI7. |
| PRIDE | Q9WTI7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000069057; ENSMUSP00000070388; ENSMUSG00000017774. ENSMUST00000102504; ENSMUSP00000099562; ENSMUSG00000017774. ENSMUST00000102505; ENSMUSP00000099563; ENSMUSG00000017774. ENSMUST00000108431; ENSMUSP00000104069; ENSMUSG00000017774. |
| GeneID | 17913. |
| KEGG | mmu:17913. |
| UCSC | uc007kem.1. mouse. uc007keo.1. mouse. |
Organism-specific databases | |
| CTD | 4641. |
| MGI | MGI:106612. Myo1c. |
Phylogenomic databases | |
| eggNOG | COG5022. |
| GeneTree | ENSGT00690000101926. |
| HOVERGEN | HBG062373. |
| InParanoid | Q3U231. |
| KO | K10356. |
| OMA | WAGRPQD. |
| OrthoDB | EOG4C5CHM. |
Enzyme and pathway databases | |
| Reactome | REACT_147847. Translocation of Glut4 to the Plasma Membrane. REACT_88307. Membrane Trafficking. |
Gene expression databases | |
| ArrayExpress | Q9WTI7. |
| Bgee | Q9WTI7. |
| CleanEx | MM_MYO1C. |
| Genevestigator | Q9WTI7. |
| GermOnline | ENSMUSG00000017774. Mus musculus. |
Family and domain databases | |
| InterPro | IPR000048. IQ_motif_EF-hand-BS. IPR001609. Myosin_head_motor_dom. IPR010926. Myosin_tail_2. [Graphical view] |
| Pfam | PF00612. IQ. 2 hits. PF00063. Myosin_head. 1 hit. PF06017. Myosin_TH1. 1 hit. [Graphical view] |
| PRINTS | PR00193. MYOSINHEAVY. |
| SMART | SM00015. IQ. 2 hits. SM00242. MYSc. 1 hit. [Graphical view] |
| PROSITE | PS50096. IQ. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MYO1C. mouse. |
| NextBio | 292757. |
| SOURCE | Search... |
Entry information
| Entry name | MYO1C_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9WTI7 Secondary accession number(s): O08571 Q9QW54 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
