Q9W2M2 (TREA_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 89.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Trehalase EC=3.2.1.28 Alternative name(s): Alpha,alpha-trehalase Alpha,alpha-trehalose glucohydrolase | ||||
| Gene names |
| ||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||
| Taxonomic identifier | 7227 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 596 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Catalytic activity | Alpha,alpha-trehalose + H2O = beta-D-glucose + alpha-D-glucose. |
| Sequence similarities | Belongs to the glycosyl hydrolase 37 family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Molecular function | Glycosidase Hydrolase |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | trehalose metabolic process Inferred from electronic annotation. Source: InterPro |
| Molecular_function | alpha,alpha-trehalase activity Traceable author statement PubMed 1582561. Source: FlyBase |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform C (identifier: Q9W2M2-1) Also known as: F; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform A (identifier: Q9W2M2-2) Also known as: D; The sequence of this isoform differs from the canonical sequence as follows: 1-53: MFKLPTISLLLVSWSCLVALSQAKTYSLPDLTTDYNNAIPVDEEEAQDPFASC → MASPANPSSNHKMNGNG | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform B (identifier: Q9W2M2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-81: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Potential | ||||||
| Chain | 24 – 596 | 573 | Trehalase | PRO_0000012058 | |||||
Amino acid modifications | |||||||||
| Glycosylation | 288 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 293 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 359 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 451 | 1 | N-linked (GlcNAc...) Ref.4 | ||||||
| Glycosylation | 516 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 81 | 81 | Missing in isoform B. | VSP_021831 | |||||
| Alternative sequence | 1 – 53 | 53 | MFKLP…PFASC → MASPANPSSNHKMNGNG in isoform A. | VSP_007735 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AE013599 Genomic DNA. Translation: AAF46668.1. AE013599 Genomic DNA. Translation: AAF46669.1. AE013599 Genomic DNA. Translation: AAM68192.1. AY051466 mRNA. Translation: AAK92890.1. |
| RefSeq | NP_001261115.1. NM_001274186.1. NP_524821.1. NM_080082.3. NP_726023.1. NM_166421.2. NP_726024.1. NM_166422.2. NP_726025.1. NM_166423.3. NP_726026.1. NM_166424.2. NP_726027.1. NM_166425.2. |
| UniGene | Dm.6686. |
3D structure databases | |
| ProteinModelPortal | Q9W2M2. |
| SMR | Q9W2M2. Positions 59-574. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-23202N. |
| IntAct | Q9W2M2. 6 interactions. |
| MINT | MINT-994217. |
Protein family/group databases | |
| CAZy | GH37. Glycoside Hydrolase Family 37. |
Proteomic databases | |
| PaxDb | Q9W2M2. |
| PRIDE | Q9W2M2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | FBtr0071539; FBpp0071468; FBgn0003748. FBtr0071540; FBpp0071469; FBgn0003748. |
| GeneID | 45368. |
| KEGG | dme:Dmel_CG9364. |
| UCSC | CG9364-RA. d. melanogaster. |
Organism-specific databases | |
| CTD | 11181. |
| FlyBase | FBgn0003748. Treh. |
Phylogenomic databases | |
| eggNOG | COG1626. |
| GeneTree | ENSGT00390000006949. |
| InParanoid | Q9W2M2. |
| KO | K01194. |
| OMA | NRYWDAS. |
| OrthoDB | EOG4MGQPK. |
| PhylomeDB | Q9W2M2. |
Gene expression databases | |
| Bgee | Q9W2M2. |
| GermOnline | CG9364. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR008928. 6-hairpin_glycosidase-like. IPR001661. Glyco_hydro_37. IPR018232. Glyco_hydro_37_CS. [Graphical view] |
| PANTHER | PTHR23403. PTHR23403. 1 hit. |
| Pfam | PF01204. Trehalase. 1 hit. [Graphical view] |
| PRINTS | PR00744. GLHYDRLASE37. |
| SUPFAM | SSF48208. Glyco_trans_6hp. 1 hit. |
| PROSITE | PS00927. TREHALASE_1. 1 hit. PS00928. TREHALASE_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 45368. |
| NextBio | 838071. |
Entry information
| Entry name | TREA_DROME | ||||||||
| Accession | Primary (citable) accession number: Q9W2M2 Secondary accession number(s): Q0E903 Q9W2M3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Glycosyl hydrolases Classification of glycosyl hydrolase families and list of entries |
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with
